Property Summary

NCBI Gene PubMed Count 18
PubMed Score 111.80
PubTator Score 295.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -2.000 4.9e-06
astrocytic glioma -2.400 3.8e-03
Astrocytoma, Pilocytic -2.000 5.9e-08
atypical teratoid / rhabdoid tumor -1.700 3.8e-08
Breast cancer 1.200 1.0e-07
ependymoma -2.500 7.5e-03
gastric carcinoma 1.300 4.9e-02
glioblastoma -1.500 4.7e-07
group 4 medulloblastoma -1.900 4.0e-05
interstitial cystitis 1.100 1.3e-03
intraductal papillary-mucinous carcinoma... 2.100 3.2e-04
intraductal papillary-mucinous neoplasm ... 1.900 2.1e-03
invasive ductal carcinoma 1.600 2.0e-04
medulloblastoma, large-cell -1.100 3.7e-03
oligodendroglioma -1.800 3.1e-02
pancreatic ductal adenocarcinoma liver m... 1.291 4.0e-02
Pick disease -1.400 9.1e-03
psoriasis 1.400 2.1e-04
subependymal giant cell astrocytoma -1.709 4.4e-02

Gene RIF (6)

AA Sequence

MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITGRIMRPDDANVAGN      1 - 70
VHGGTILKMIEEAGAIISTRHCNSQNGERCVAALARVERTDFLSPMCIGEVAHVSAEITYTSKHSVEVQV     71 - 140
NVMSENILTGAKKLTNKATLWYVPLSLKNVDKVLEVPPVVYSRQEQEEEGRKRYEAQKLERMETKWRNGD    141 - 210
IVQPVLNPEPNTVSYSQSSLIHLVGPSDCTLHGFVHGGVTMKLMDEVAGIVAARHCKTNIVTASVDAINF    211 - 280
HDKIRKGCVITISGRMTFTSNKSMEIEVLVDADPVVDSSQKRYRAASAFFTYVSLSQEGRSLPVPQLVPE    281 - 350
TEDEKKRFEEGKGRYLQMKAKRQGHAEPQP                                            351 - 380
//

Text Mined References (20)

PMID Year Title