Property Summary

NCBI Gene PubMed Count 17
PubMed Score 106.76
PubTator Score 295.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 3.76741639325796E-8
pilocytic astrocytoma 3086 7.16786903850443E-8
Breast cancer 3099 1.00897390849918E-7
adult high grade glioma 2148 1.43237408979179E-5
group 4 medulloblastoma 1875 3.96100938067295E-5
glioblastoma 5572 1.30508746084176E-4
invasive ductal carcinoma 2950 2.04369427882872E-4
psoriasis 6685 2.05544446053236E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.17406657451624E-4
interstitial cystitis 2299 0.00131683664055507
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00209469876914635
medulloblastoma, large-cell 6234 0.00366109856316156
astrocytic glioma 2241 0.00378608639964463
ependymoma 2514 0.00752505230881188
Pick disease 1893 0.00913882583947899
oligodendroglioma 2849 0.0309428750649353
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0401851440529968
subependymal giant cell astrocytoma 2287 0.0437037353077033
gastric carcinoma 832 0.0486009662624992
Disease Target Count Z-score Confidence
Meckel's diverticulum 4 3.208 1.6

Expression

Synonym

Accession O00154 A8K0K7 A8K232 A8K6B8 A8K837 B3KQ12 O43703 Q53Y78 Q5JYL2 Q5JYL3 Q5JYL4 Q5JYL5 Q5JYL6 Q5TGR4 Q9UJM9 Q9Y539 Q9Y540
Symbols ACT
ACH1
BACH
LACH
LACH1
hBACH
CTE-II

Gene

PANTHER Protein Class (2)

PDB

2QQ2  

  Ortholog (9)

Gene RIF (5)

PMID Text
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19724895 Observational study of gene-disease association. (HuGE Navigator)
15592755 BACH was deranged in hippocampus of mesial temporal lobe epilepsy patients.
12435388 the human BACH gene can express long-chain acyl-CoA hydrolase activity in multiple intracellular compartments by generating BACH isoforms with differential localization signals to affect various cellular functions that involve acyl-CoAs

AA Sequence

MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITGRIMRPDDANVAGN      1 - 70
VHGGTILKMIEEAGAIISTRHCNSQNGERCVAALARVERTDFLSPMCIGEVAHVSAEITYTSKHSVEVQV     71 - 140
NVMSENILTGAKKLTNKATLWYVPLSLKNVDKVLEVPPVVYSRQEQEEEGRKRYEAQKLERMETKWRNGD    141 - 210
IVQPVLNPEPNTVSYSQSSLIHLVGPSDCTLHGFVHGGVTMKLMDEVAGIVAARHCKTNIVTASVDAINF    211 - 280
HDKIRKGCVITISGRMTFTSNKSMEIEVLVDADPVVDSSQKRYRAASAFFTYVSLSQEGRSLPVPQLVPE    281 - 350
TEDEKKRFEEGKGRYLQMKAKRQGHAEPQP                                            351 - 380
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21269460 2011 Initial characterization of the human central proteome.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19724895 2009 Association of gene polymorphisms with chronic kidney disease in Japanese individuals.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19305408 2009 Common variants at ten loci influence QT interval duration in the QTGEN Study.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
More...