Property Summary

NCBI Gene PubMed Count 30
PubMed Score 293.49
PubTator Score 21.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Breast cancer -1.500 1.3e-05
chronic kidney disease 1.400 6.1e-03
ependymoma 1.600 7.4e-05
glioblastoma 1.100 4.6e-03
lung adenocarcinoma -1.100 2.7e-13
lung cancer -2.600 5.1e-05
lung carcinoma -1.600 4.5e-22
medulloblastoma, large-cell 3.200 1.4e-04
ovarian cancer -1.300 1.5e-03
pediatric high grade glioma 1.600 1.4e-04
primitive neuroectodermal tumor 1.600 2.3e-02
sonic hedgehog group medulloblastoma 1.100 6.0e-03
spina bifida -1.550 4.9e-02
Waldenstrons macroglobulinemia -1.050 2.5e-02

Gene RIF (14)

AA Sequence

MTTQQIDLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAALANLCIGDVITAIDGENTSNMTHLEAQNRI      1 - 70
KGCTDNLTLTVARSEHKVWSPLVTEEGKRHPYKMNLASEPQEVLHIGSAHNRSAMPFTASPASSTTARVI     71 - 140
TNQYNNPAGLYSSENISNFNNALESKTAASGVEANSRPLDHAQPPSSLVIDKESEVYKMLQEKQELNEPP    141 - 210
KQSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRH    211 - 280
PECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVTPPEGYEVVTVFPK                         281 - 329
//

Text Mined References (41)

PMID Year Title