Property Summary

NCBI Gene PubMed Count 29
PubMed Score 248.65
PubTator Score 21.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.050 0.025
glioblastoma 2.000 0.000
ependymoma 1.600 0.000
medulloblastoma, large-cell 3.200 0.000
primitive neuroectodermal tumor 1.600 0.023
chronic kidney disease 1.400 0.006
lung cancer -3.700 0.000
lung adenocarcinoma -1.500 0.000
pediatric high grade glioma 1.600 0.000
sonic hedgehog group medulloblastoma 1.100 0.006
lung carcinoma -1.600 0.000
spina bifida -1.550 0.049
Breast cancer -1.500 0.000
ovarian cancer 1.800 0.001

Synonym

Accession O00151 B2RBS6 Q5VZH5 Q9BPZ9
Symbols CLIM1
CLP36
CLP-36
hCLIM1
HEL-S-112

Gene

PDB

1X62   2PKT  

Gene RIF (13)

PMID Text
26701804 downregulation of PDLIM1 in colorectal cancer samples correlated with reduced E-cadherin and membrane beta-catenin levels
26119933 PDLIM1 was shown to interact with p75(NTR) in highly invasive patient-derived glioma stem cells/tumor-initiating cells and shRNA knockdown of PDLIM1 in vitro and in vivo results in complete ablation of p75(NTR)-mediated invasion.
24662836 Our results identify CLP36 as an important regulator of breast cancer cell migration and metastasis, and shed light on how increased CLP36 expression contributes to the progression of breast cancer.
22922308 Femtomolar Zn2+ affinity of LIM domain of PDLIM1 protein uncovers crucial contribution of protein-protein interactions to protein stability.
22851037 Robust co-regulation of tyrosine phosphorylation sites has been revealed on novel protein interactions between EGFR and PDLIM1.
21680739 Alpha-actinin-4 and CLP36 protein deficiencies contribute to podocyte defects in multiple human glomerulopathies
21651830 PDLIM1 showed moderate parent-of origin effects for some single nucleotide polymorphisms in attention deficit disorder with hyperactivity.
17213842 Observational study of gene-disease association. (HuGE Navigator)
16609848 We present evidence for the exclusive protein expression of CLP36 in proliferative and early post-proliferative trophoblast cells.
16385451 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MTTQQIDLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAALANLCIGDVITAIDGENTSNMTHLEAQNRI      1 - 70
KGCTDNLTLTVARSEHKVWSPLVTEEGKRHPYKMNLASEPQEVLHIGSAHNRSAMPFTASPASSTTARVI     71 - 140
TNQYNNPAGLYSSENISNFNNALESKTAASGVEANSRPLDHAQPPSSLVIDKESEVYKMLQEKQELNEPP    141 - 210
KQSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRH    211 - 280
PECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVTPPEGYEVVTVFPK                         281 - 329
//

Text Mined References (40)

PMID Year Title
26701804 2016 PDLIM1 Stabilizes the E-Cadherin/?-Catenin Complex to Prevent Epithelial-Mesenchymal Transition and Metastatic Potential of Colorectal Cancer Cells.
26119933 2016 Glioma invasion mediated by the p75 neurotrophin receptor (p75(NTR)/CD271) requires regulated interaction with PDLIM1.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24662836 2015 PDZ and LIM domain protein 1(PDLIM1)/CLP36 promotes breast cancer cell migration, invasion and metastasis through interaction with ?-actinin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22922308 2012 Femtomolar Zn2+ affinity of LIM domain of PDLIM1 protein uncovers crucial contribution of protein-protein interactions to protein stability.
22851037 2012 Robust co-regulation of tyrosine phosphorylation sites on proteins reveals novel protein interactions.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21680739 2011 Alpha-actinin-4 and CLP36 protein deficiencies contribute to podocyte defects in multiple human glomerulopathies.
More...