Property Summary

NCBI Gene PubMed Count 35
PubMed Score 16.52
PubTator Score 22.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
acute quadriplegic myopathy 1.240 1.4e-07
adrenocortical carcinoma 1.204 1.2e-03
adult high grade glioma 1.200 5.3e-04
astrocytoma 1.300 5.0e-21
atypical teratoid / rhabdoid tumor 1.300 5.1e-06
Breast cancer 1.100 4.4e-11
colon cancer 1.600 7.9e-03
glioblastoma 1.600 4.2e-10
group 3 medulloblastoma 1.700 1.2e-04
interstitial cystitis 1.100 3.9e-04
intraductal papillary-mucinous carcinoma... 1.100 4.4e-03
intraductal papillary-mucinous neoplasm ... 1.700 2.4e-03
invasive ductal carcinoma 1.200 2.2e-03
juvenile dermatomyositis 1.031 7.8e-12
lung cancer 1.200 1.9e-02
malignant mesothelioma 1.300 2.8e-06
medulloblastoma, large-cell 1.800 1.4e-04
Multiple myeloma 1.110 3.3e-03
non-small cell lung cancer 1.079 5.9e-13
oligodendroglioma 1.400 1.9e-13
ovarian cancer 3.200 5.8e-08
pancreatic ductal adenocarcinoma liver m... 1.167 8.9e-03
primitive neuroectodermal tumor 1.500 1.4e-03
psoriasis 2.300 3.1e-05

Protein-protein Interaction (6)

Gene RIF (14)

AA Sequence

MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEV      1 - 70
QHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMP     71 - 140
SVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDV    141 - 210
QEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDL    211 - 280
LDVLEFNQVIIFVKSVQRCMALAQLLVEQNFPAIAIHRGMAQEERLSRYQQFKDFQRRILVATNLFGRGM    281 - 350
DIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNVAELPEEIDIS    351 - 420
TYIEQSR                                                                   421 - 427
//

Text Mined References (46)

PMID Year Title