Property Summary

NCBI Gene PubMed Count 34
Grant Count 3
R01 Count 3
Funding $539,314
PubMed Score 16.46
PubTator Score 22.42

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O00148 B1Q2N1 Q8N5M0 Q9BVP6 Q9H5W0
Symbols BAT1
DDXL
BAT1L
DDX39
URH49

Gene

Gene RIF (13)

PMID Text
26469522 DDX39A is a potential biomarker for unfavorable neuroblastoma
23749908 The protein levels of DDX39 were found to be higher in malignant pleural mesothelioma cell lines compared to normal pleural mesothelial cells.
22494014 Results suggest that DDX39 is a suppressor of invasion and loss of its function predicts disease progression in bladder cancers.
22119546 -dependent RNA helicase DDX39 has a role in poor prognosis of patients with gastrointestinal stromal tumor
21859714 Mx proteins exert their antiviral activity against IAV by interfering with the function of the RNA helicases UAP56 and URH49
21799930 UAP56 and URH49 exhibit an intrinsic CRM1-independent nucleocytoplasmic shuttling
21388492 Requirement of DDX39 DEAD box RNA helicase for genome integrity and telomere protection
20610707 Using a UL69 viral mutant that is unable to bind UAP56 and URH49, the authors demonstrated that UL69's interaction with UAP56 or URH49 does not contribute to the growth phenotype associated with the UL69 deletion mutant.
20573985 Data show that the two closely related RNA helicases UAP56 and URH49 have evolved to form distinct mRNA export machineries, which regulate mitosis at different steps.
17548965 DDX39 is a novel RNA helicase capable of promoting cancer cell growth
More...

AA Sequence

MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEV      1 - 70
QHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMP     71 - 140
SVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDV    141 - 210
QEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDL    211 - 280
LDVLEFNQVIIFVKSVQRCMALAQLLVEQNFPAIAIHRGMAQEERLSRYQQFKDFQRRILVATNLFGRGM    281 - 350
DIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNVAELPEEIDIS    351 - 420
TYIEQSR                                                                   421 - 427
//

Text Mined References (44)

PMID Year Title
26469522 2016 Identification of DDX39A as a Potential Biomarker for Unfavorable Neuroblastoma Using a Proteomic Approach.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23749908 2013 Up-regulation of DDX39 in human malignant pleural mesothelioma cell lines compared to normal pleural mesothelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22494014 2012 DDX39 acts as a suppressor of invasion for bladder cancer.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22197932 2011 Meta-analysis of genome-wide association studies identifies three new risk loci for atopic dermatitis.
More...