Property Summary

NCBI Gene PubMed Count 40
Grant Count 61
R01 Count 48
Funding $9,523,904.03
PubMed Score 4.61
PubTator Score 111.05

Knowledge Summary

Patent (188,631)

Expression

  Differential Expression (12)

Disease log2 FC p
pancreatic cancer 1.100 0.002
malignant mesothelioma -2.200 0.000
psoriasis -3.200 0.000
osteosarcoma -2.702 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor -1.100 0.014
lung cancer -1.200 0.002
pancreatic carcinoma 1.100 0.002
subependymal giant cell astrocytoma 1.226 0.008
invasive ductal carcinoma -1.500 0.005
ovarian cancer 1.500 0.002

Synonym

Accession O00142 B4DGJ7 B4DZK7 B7ZAB1 E9PH08 O15238
Symbols MTTK
PEOB3
SCA31
MTDPS2

Gene

TK2

PANTHER Protein Class (3)

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

Gene RIF (27)

PMID Text
25948719 Severe deficiency of thymidine kinase 2 was associated with patients with mild forms of myopathy.
25215937 Data indicate that the thymidine kinase 2 enzyme kinetics of thymidine (dT) phosphorylation exhibits negative cooperativity, but deoxycytidine (dC) phosphorylation follows hyperbolic Michaelis-Menten kinetics.
24940680 thymidine kinase 2 but not deoxyguanosine kinase is up-regulated during the stationary growth phase of cultured cells
24455740 We suggest that a chip including DPYD, TYMS, TYMP, TK1, and TK2 genes is a potential tool to predict response in LARC following fluoropyrimidine-based CCRT.
24198295 Thymidine kinase-2 mutations causing mtDNA deletions are linked to a case of late-onset respiratory failure.
23932787 Clinically, hypotonia and proximal muscle weakness are the major phenotypes present in all subjects. In summary, our study expands the molecular and clinical spectrum associated with TK2 deficiency.
22661713 Results strongly suggest that oxidative damage-induced S-glutathionylation and degradation of TK2 have significant impact on mitochondrial DNA precursor synthesis.
21937588 R225W and T230A mutation of TK2 leads to a significant reduction activity in autosomal recessive progressive external ophthalmoplegia patients.
21382338 TK2-deficient cells showed severe mtDNA depletion.
20877624 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLLWPLRGWAARALRCFGPGSRGSPASGPGPRRVQRRAWPPDKEQEKEKKSVICVEGNIASGKTTCLEFF      1 - 70
SNATDVEVLTEPVSKWRNVRGHNPLGLMYHDASRWGLTLQTYVQLTMLDRHTRPQVSSVRLMERSIHSAR     71 - 140
YIFVENLYRSGKMPEVDYVVLSEWFDWILRNMDVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLE    141 - 210
AIHHLHEEWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRDRILTPENRKHCP                   211 - 265
//

Text Mined References (43)

PMID Year Title
25948719 2015 Severe TK2 enzyme activity deficiency in patients with mild forms of myopathy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25446393 2015 Clinical application of whole exome sequencing reveals a novel compound heterozygous TK2-mutation in two brothers with rapidly progressive combined muscle-brain atrophy, axonal neuropathy, and status epilepticus.
25215937 2014 Thymidine kinase 2 enzyme kinetics elucidate the mechanism of thymidine-induced mitochondrial DNA depletion.
24940680 2014 Mitochondrial thymidine kinase 2 but not deoxyguanosine kinase is up-regulated during the stationary growth phase of cultured cells.
24455740 2013 DPYD, TYMS, TYMP, TK1, and TK2 genetic expressions as response markers in locally advanced rectal cancer patients treated with fluoropyrimidine-based chemoradiotherapy.
24198295 2013 Late-onset respiratory failure due to TK2 mutations causing multiple mtDNA deletions.
23932787 Molecular and clinical characterization of the myopathic form of mitochondrial DNA depletion syndrome caused by mutations in the thymidine kinase (TK2) gene.
22661713 2012 Oxidative stress induced S-glutathionylation and proteolytic degradation of mitochondrial thymidine kinase 2.
21937588 2012 Thymidine kinase 2 mutations in autosomal recessive progressive external ophthalmoplegia with multiple mitochondrial DNA deletions.
More...