Property Summary

Ligand Count 1
NCBI Gene PubMed Count 41
PubMed Score 5.62
PubTator Score 111.05

Knowledge Summary

Patent (188,631)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Chronic progressive external ophthalmoplegia 26 3.917 2.0

Expression

  Differential Expression (12)

Disease log2 FC p
group 3 medulloblastoma -1.100 5.5e-04
invasive ductal carcinoma -1.400 1.4e-02
lung cancer -1.200 2.0e-03
malignant mesothelioma -2.000 3.7e-07
medulloblastoma, large-cell -1.800 1.4e-04
osteosarcoma -2.261 1.0e-05
ovarian cancer -1.300 2.6e-05
pancreatic cancer 1.100 2.0e-03
pancreatic carcinoma 1.100 2.0e-03
primitive neuroectodermal tumor -1.100 1.4e-02
psoriasis -1.300 1.4e-04
subependymal giant cell astrocytoma 1.226 7.8e-03

Gene RIF (28)

AA Sequence

MLLWPLRGWAARALRCFGPGSRGSPASGPGPRRVQRRAWPPDKEQEKEKKSVICVEGNIASGKTTCLEFF      1 - 70
SNATDVEVLTEPVSKWRNVRGHNPLGLMYHDASRWGLTLQTYVQLTMLDRHTRPQVSSVRLMERSIHSAR     71 - 140
YIFVENLYRSGKMPEVDYVVLSEWFDWILRNMDVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLE    141 - 210
AIHHLHEEWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRDRILTPENRKHCP                   211 - 265
//

Text Mined References (45)

PMID Year Title