Property Summary

NCBI Gene PubMed Count 191
Grant Count 326
R01 Count 198
Funding $31,122,237.34
PubMed Score 469.93
PubTator Score 290.80

Knowledge Summary

Patent (31,010)

Expression

  Differential Expression (23)

Disease log2 FC p
gastric cancer -1.200 0.039
chronic lymphosyte leukemia -1.800 0.000
malignant mesothelioma -1.300 0.000
acute quadriplegic myopathy -1.107 0.016
Atopic dermatitis 1.200 0.000
adrenocortical carcinoma -1.956 0.000
pancreatic ductal adenocarcinoma liver m... -1.145 0.025
intraductal papillary-mucinous neoplasm ... -2.000 0.009
lung cancer -1.300 0.004
colon cancer -1.500 0.002
active Crohn's disease -3.012 0.005
diabetes mellitus -1.200 0.049
interstitial cystitis 1.500 0.016
group 3 medulloblastoma 1.500 0.009
pilocytic astrocytoma 1.600 0.001
Breast cancer -2.500 0.000
lung carcinoma -2.100 0.000
ductal carcinoma in situ 1.100 0.014
acute myeloid leukemia 1.200 0.046
ovarian cancer -3.000 0.000
pituitary cancer 1.400 0.011
Down syndrome 1.900 0.000
psoriasis 1.400 0.000

Gene

PDB

2R5T   3HDM   3HDN  

Gene RIF (158)

PMID Text
26658840 Highly recurrent mutation of GSK1 is associated with nodular lymphocyte predominant Hodgkin lymphoma.
26548813 SGK1 is overexpressed in non-small cell lung cancer.SGK1 positively regulates the growth, migration and metastasis of non-small cell lung cancer.SGK1 activates beta-catenin signaling in NSCLC cells.
26506154 Data suggest that SGK1 expression is down-regulated in prefrontal cortex neurons of post-traumatic stress disorders subjects (male and female; postmortem samples obtained from tissue bank).
26491696 This review focuses on recent advances in understanding of the roles of Akt and SGK1 in the regulation of renal tubular transport.
26429539 SGK1 was up-regulated in CD4 T cells
26359301 data suggest that the induction of SGK1 through treatment with dexamethasone alters MT dynamics to increase Sec5-GEF-H1 interactions, which promote GEF-H1 targeting to adhesion sites.
26277930 After adjustment for multiple testing, single-nucleotide polymorphism rs9376026 was significantly associated with diastolic blood pressure and mean arterial pressure responses to low-sodium intervention
26230157 The results from this study may be of particular importance, because SGK1WT over-expression by activating telomerase and reducing reactive oxygen species levels may delay the processes of endothelial senescence.
26188042 FE65 influences APP degradation via the proteasome, and phosphorylation of FE65 Ser(610) by SGK1 regulates binding of FE65 to APP, APP turnover and processing.
26038830 mRNA levels of ARC and SGK1 did not differ significantly between the schizophrenia or control samples.
More...

AA Sequence

MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMN      1 - 70
ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEE     71 - 140
KHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASAL    141 - 210
GYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDW    211 - 280
WCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIK    281 - 350
SHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLG    351 - 420
FSYAPPTDSFL                                                               421 - 431
//

Text Mined References (213)

PMID Year Title
26658840 2016 Highly recurrent mutations of SGK1, DUSP2 and JUNB in nodular lymphocyte predominant Hodgkin lymphoma.
26548813 2016 Serum and glucocorticoid kinase 1 promoted the growth and migration of non-small cell lung cancer cells.
26506154 2015 Decreased SGK1 Expression and Function Contributes to Behavioral Deficits Induced by Traumatic Stress.
26491696 2015 Roles of Akt and SGK1 in the Regulation of Renal Tubular Transport.
26429539 2015 [Up-regulation of serum- and glucocorticoid-inducible kinase 1 (SGK1) of CD4? T cells is positively related to RORC and IL-17A in patients with Kawasaki disease].
26359301 2015 Dexamethasone-induced cellular tension requires a SGK1-stimulated Sec5-GEF-H1 interaction.
26277930 2015 Common Variants in Serum/Glucocorticoid Regulated Kinase 1 (SGK1) and Blood Pressure Responses to Dietary Sodium or Potassium Interventions: A family-Based Association Study.
26230157 2016 Serum- and Glucocorticoid-Inducible Kinase 1 Delay the Onset of Endothelial Senescence by Directly Interacting with Human Telomerase Reverse Transcriptase.
26188042 2015 Phosphorylation of FE65 Ser610 by serum- and glucocorticoid-induced kinase 1 modulates Alzheimer's disease amyloid precursor protein processing.
26038830 2015 Altered Markers of Cortical ?-Aminobutyric Acid Neuronal Activity in Schizophrenia: Role of the NARP Gene.
More...