Property Summary

NCBI Gene PubMed Count 38
PubMed Score 42.73
PubTator Score 69.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.045 2.8e-02
adrenocortical carcinoma 1.530 2.4e-04
cutaneous lupus erythematosus 1.600 4.9e-04
lung cancer 1.400 3.0e-03
malignant mesothelioma 1.500 6.3e-07
non-small cell lung cancer 1.734 3.7e-25
osteosarcoma -1.005 9.3e-03
ovarian cancer 2.000 1.0e-04
primary Sjogren syndrome 1.200 1.5e-03

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (29)

AA Sequence

MATANFGKIQIGIYVEIKRSDGRIHQAMVTSLNEDNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPDE      1 - 70
EIEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPSQFPEQSSSAQQNGSVSDIS     71 - 140
PVQAAKKEFGPPSRRKSNCVKEVEKLQEKREKRRLQQQELREKRAQDVDATNPNYEIMCMIRDFRGSLDY    141 - 210
RPLTTADPIDEHRICVCVRKRPLNKKETQMKDLDVITIPSKDVVMVHEPKQKVDLTRYLENQTFRFDYAF    211 - 280
DDSAPNEMVYRFTARPLVETIFERGMATCFAYGQTGSGKTHTMGGDFSGKNQDCSKGIYALAARDVFLML    281 - 350
KKPNYKKLELQVYATFFEIYSGKVFDLLNRKTKLRVLEDGKQQVQVVGLQEREVKCVEDVLKLIDIGNSC    351 - 420
RTSGQTSANAHSSRSHAVFQIILRRKGKLHGKFSLIDLAGNERGADTSSADRQTRLEGAEINKSLLALKE    421 - 490
CIRALGRNKPHTPFRASKLTQVLRDSFIGENSRTCMIATISPGMASCENTLNTLRYANRVKELTVDPTAA    491 - 560
GDVRPIMHHPPNQIDDLETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVEDHRA    561 - 630
VFQESIRWLEDEKALLEMTEEVDYDVDSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINP    631 - 700
KRPRAL                                                                    701 - 706
//

Text Mined References (45)

PMID Year Title