Property Summary

NCBI Gene PubMed Count 30
Grant Count 4
R01 Count 1
Funding $138,226.33
PubMed Score 35.88
PubTator Score 69.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
cutaneous lupus erythematosus 1.600 0.000
osteosarcoma -1.005 0.009
adrenocortical carcinoma 1.530 0.000
non-small cell lung cancer 1.734 0.000
lung cancer 1.500 0.009
active Crohn's disease 1.045 0.028
primary Sjogren syndrome 1.200 0.002
ovarian cancer 2.000 0.000

Gene RIF (22)

PMID Text
26707290 KIF2A may be important in glioma progression.
26323690 TTBK2 phosphorylates KIF2A and antagonizes KIF2A-induced depolymerization at microtubules plus ends for cell migration.
26070867 This study demonstrated colorectal cancer (CRC) tissue-preferred expression pattern of the KIF2A and suggested that high KIF2A expression might serve as an independent maker for poor prognosis in CRC patients.
25002494 up-regulation of KIF2C and KIF2A by ERK1/2 caused aberrant lysosomal positioning and mTORC1 activity in a mutant K-Ras-dependent cancer and cancer model.
24950762 KIF2A may play an important role in breast cancer progression and is potentially a novel predictive and prognostic marker for breast cancer.
24248467 Silencing Kif2a induces apoptosis and decreases the mRNA and protein level of PI3K, Akt and Bcell lymphoma 2 (Bcl2) in Tca8113 cells.
24240690 Ras regulates KIF2A to control cell migration pathways in transformed human bronchial epithelial cells.
23960144 The distribution of Kif2A was limited to the distal ends of the central spindle through Aurora B-dependent phosphorylation and exclusion from the spindle midzone.
23166591 Expression of HIV-1 Tat downregulates the abundance of kinesin heavy chain member 2A (KIF2A) in the nucleoli of Jurkat T-cells
22184201 The kinesin-2 deficiency weakened intercellular adhesion, despite the maintenance of adherens junctions and other desmosome components at the plasma membrane.
More...

AA Sequence

MATANFGKIQIGIYVEIKRSDGRIHQAMVTSLNEDNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPDE      1 - 70
EIEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPSQFPEQSSSAQQNGSVSDIS     71 - 140
PVQAAKKEFGPPSRRKSNCVKEVEKLQEKREKRRLQQQELREKRAQDVDATNPNYEIMCMIRDFRGSLDY    141 - 210
RPLTTADPIDEHRICVCVRKRPLNKKETQMKDLDVITIPSKDVVMVHEPKQKVDLTRYLENQTFRFDYAF    211 - 280
DDSAPNEMVYRFTARPLVETIFERGMATCFAYGQTGSGKTHTMGGDFSGKNQDCSKGIYALAARDVFLML    281 - 350
KKPNYKKLELQVYATFFEIYSGKVFDLLNRKTKLRVLEDGKQQVQVVGLQEREVKCVEDVLKLIDIGNSC    351 - 420
RTSGQTSANAHSSRSHAVFQIILRRKGKLHGKFSLIDLAGNERGADTSSADRQTRLEGAEINKSLLALKE    421 - 490
CIRALGRNKPHTPFRASKLTQVLRDSFIGENSRTCMIATISPGMASCENTLNTLRYANRVKELTVDPTAA    491 - 560
GDVRPIMHHPPNQIDDLETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVEDHRA    561 - 630
VFQESIRWLEDEKALLEMTEEVDYDVDSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINP    631 - 700
KRPRAL                                                                    701 - 706
//

Text Mined References (37)

PMID Year Title
27697924 2016 ASB7 regulates spindle dynamics and genome integrity by targeting DDA3 for proteasomal degradation.
26707290 2016 Role of KIF2A in the progression and metastasis of human glioma.
26323690 2015 TTBK2 with EB1/3 regulates microtubule dynamics in migrating cells through KIF2A phosphorylation.
26070867 2015 KIF2A overexpression and its association with clinicopathologic characteristics and unfavorable prognosis in colorectal cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25002494 2014 Ras transformation uncouples the kinesin-coordinated cellular nutrient response.
24950762 2014 KIF2A silencing inhibits the proliferation and migration of breast cancer cells and correlates with unfavorable prognosis in breast cancer.
24248467 2014 Silencing Kif2a induces apoptosis in squamous cell carcinoma of the oral tongue through inhibition of the PI3K/Akt signaling pathway.
24240690 2014 Ras regulates kinesin 13 family members to control cell migration pathways in transformed human bronchial epithelial cells.
23960144 2013 Aurora B and Kif2A control microtubule length for assembly of a functional central spindle during anaphase.
More...