Property Summary

NCBI Gene PubMed Count 32
PubMed Score 679.51
PubTator Score 651.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.100 1.1e-03
Astrocytoma, Pilocytic 1.300 1.2e-04
atypical teratoid / rhabdoid tumor -1.200 2.6e-05
Breast cancer -1.100 5.5e-03
diabetes mellitus -1.100 1.3e-03
ependymoma 1.100 2.2e-05
glioblastoma 1.500 1.1e-09
intraductal papillary-mucinous adenoma (... 1.100 2.6e-02
intraductal papillary-mucinous neoplasm ... 1.200 1.3e-02
invasive ductal carcinoma -1.700 2.6e-03
juvenile dermatomyositis 1.177 1.4e-08
medulloblastoma, large-cell 1.600 4.8e-04
ovarian cancer -1.600 2.0e-07
primitive neuroectodermal tumor 1.300 9.3e-05
sonic hedgehog group medulloblastoma 1.200 4.6e-04
tuberculosis 1.300 3.2e-06

Protein-protein Interaction (1)

Gene RIF (10)

AA Sequence

MAEAAAAAGGTGLGAGASYGSAADRDRDPDPDRAGRRLRVLSGHLLGRPREALSTNECKARRAASAATAA      1 - 70
PTATPAAQESGTIPKKRQEVMKWNGWGYNDSKFIFNKKGQIELTGKRYPLSGMGLPTFKEWIQNTLGVNV     71 - 140
EHKTTSKASLNPSDTPPSVVNEDFLHDLKETNISYSQEADDRVFRAHGHCLHEIFLLREGMFERIPDIVL    141 - 210
WPTCHDDVVKIVNLACKYNLCIIPIGGGTSVSYGLMCPADETRTIISLDTSQMNRILWVDENNLTAHVEA    211 - 280
GITGQELERQLKESGYCTGHEPDSLEFSTVGGWVSTRASGMKKNIYGNIEDLVVHIKMVTPRGIIEKSCQ    281 - 350
GPRMSTGPDIHHFIMGSEGTLGVITEATIKIRPVPEYQKYGSVAFPNFEQGVACLREIAKQRCAPASIRL    351 - 420
MDNKQFQFGHALKPQVSSIFTSFLDGLKKFYITKFKGFDPNQLSVATLLFEGDREKVLQHEKQVYDIAAK    421 - 490
FGGLAAGEDNGQRGYLLTYVIAYIRDLALEYYVLGESFETSAPWDRVVDLCRNVKERITRECKEKGVQFA    491 - 560
PFSTCRVTQTYDAGACIYFYFAFNYRGISDPLTVFEQTEAAAREEILANGGSLSHHHGVGKLRKQWLKES    561 - 630
ISDVGFGMLKSVKEYVDPNNIFGNRNLL                                              631 - 658
//

Text Mined References (40)

PMID Year Title