Property Summary

NCBI Gene PubMed Count 32
Grant Count 46
R01 Count 12
Funding $12,198,102.99
PubMed Score 606.76
PubTator Score 651.49

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
25542233 we optimized the BITC construction targeting alkylglycerone phosphate synthase (AGPS) by computer-aided design, and the derivants also showed anti-tumor potential in vitro.
25505242 The interaction of HIV-1 CA with human cellular alkylglycerone phosphate synthase protein (AGPS) is identified by yeast two-hybrid screen
24841318 Results demonstrated that AGPS negatively regulated the invasion potential of glioma and hepatic carcinoma cells by modulating the expression of relevant genes and activity of the MAPK pathway.
24815474 AGPS overexpression could be a causation of chemotherapy agent resistance of cancer cells. AGPS silencing could lead to drug uptake and cell cycle arrest and apoptotic cell death.
23980144 AGPS, in addition to maintaining ether lipids, also controls cellular utilization of fatty acids, favoring the generation of signaling lipids necessary for promoting the aggressive features of cancer.
22190034 The interaction of HIV-1 CA with human cellular alkylglycerone phosphate synthase protein (AGPS) is identified by yeast two-hybrid screen
21990100 Novel mutations in AGPS (alkylglycerone-phosphate synthase) cause rhizomelic chondrodysplasia punctata (RCDP) type 3.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18571506 Defect of ADAPS expression was also assessed by immunoblot

AA Sequence

MAEAAAAAGGTGLGAGASYGSAADRDRDPDPDRAGRRLRVLSGHLLGRPREALSTNECKARRAASAATAA      1 - 70
PTATPAAQESGTIPKKRQEVMKWNGWGYNDSKFIFNKKGQIELTGKRYPLSGMGLPTFKEWIQNTLGVNV     71 - 140
EHKTTSKASLNPSDTPPSVVNEDFLHDLKETNISYSQEADDRVFRAHGHCLHEIFLLREGMFERIPDIVL    141 - 210
WPTCHDDVVKIVNLACKYNLCIIPIGGGTSVSYGLMCPADETRTIISLDTSQMNRILWVDENNLTAHVEA    211 - 280
GITGQELERQLKESGYCTGHEPDSLEFSTVGGWVSTRASGMKKNIYGNIEDLVVHIKMVTPRGIIEKSCQ    281 - 350
GPRMSTGPDIHHFIMGSEGTLGVITEATIKIRPVPEYQKYGSVAFPNFEQGVACLREIAKQRCAPASIRL    351 - 420
MDNKQFQFGHALKPQVSSIFTSFLDGLKKFYITKFKGFDPNQLSVATLLFEGDREKVLQHEKQVYDIAAK    421 - 490
FGGLAAGEDNGQRGYLLTYVIAYIRDLALEYYVLGESFETSAPWDRVVDLCRNVKERITRECKEKGVQFA    491 - 560
PFSTCRVTQTYDAGACIYFYFAFNYRGISDPLTVFEQTEAAAREEILANGGSLSHHHGVGKLRKQWLKES    561 - 630
ISDVGFGMLKSVKEYVDPNNIFGNRNLL                                              631 - 658
//

Text Mined References (40)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25542233 2015 The effect of benzyl isothiocyanate and its computer-aided design derivants targeting alkylglycerone phosphate synthase on the inhibition of human glioma U87MG cell line.
25416956 2014 A proteome-scale map of the human interactome network.
24841318 2014 Role and mechanism of the alkylglycerone phosphate synthase in suppressing the invasion potential of human glioma and hepatic carcinoma cells in vitro.
24815474 2014 Alkylglyceronephosphate synthase (AGPS) alters lipid signaling pathways and supports chemotherapy resistance of glioma and hepatic carcinoma cell lines.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23980144 2013 Ether lipid generating enzyme AGPS alters the balance of structural and signaling lipids to fuel cancer pathogenicity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21990100 2012 Functional characterization of novel mutations in GNPAT and AGPS, causing rhizomelic chondrodysplasia punctata (RCDP) types 2 and 3.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
More...