Property Summary

NCBI Gene PubMed Count 33
PubMed Score 109.60
PubTator Score 50.96

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 3.1e-06
atypical teratoid / rhabdoid tumor 1.200 1.5e-04
group 3 medulloblastoma 1.100 2.2e-04
malignant mesothelioma -2.900 5.7e-07
osteosarcoma 1.372 7.0e-05
ovarian cancer -1.300 2.0e-04
pediatric high grade glioma 1.100 3.8e-06
psoriasis -1.400 5.2e-04

Protein-protein Interaction (1)

Gene RIF (10)

AA Sequence

MIPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQYKYLDESSGGWRDGRALINS      1 - 70
PEGAVGRSLQPLYRSNTSQLAFLLYNDQPPQPSKAQDSSMRGHTKGVLLLDHDGGFWLVHSVPNFPPPAS     71 - 140
SAAYSWPHSACTYGQTLLCVSFPFAQFSKMGKQLTYTYPWVYNYQLEGIFAQEFPDLENVVKGHHVSQEP    141 - 210
WNSSITLTSQAGAVFQSFAKFSKFGDDLYSGWLAAALGTNLQVQFWHKTVGILPSNCSDIWQVLNVNQIA    211 - 280
FPGPAGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGM    281 - 350
ARKPSRAYKI                                                                351 - 360
//

Text Mined References (37)

PMID Year Title