Property Summary

NCBI Gene PubMed Count 32
Grant Count 22
R01 Count 16
Funding $5,095,083.48
PubMed Score 97.74
PubTator Score 50.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -4.200 0.000
psoriasis -1.400 0.001
osteosarcoma 1.478 0.001
atypical teratoid/rhabdoid tumor 1.400 0.000
pediatric high grade glioma 1.100 0.000
group 3 medulloblastoma 1.100 0.000
pilocytic astrocytoma 1.100 0.000
ovarian cancer -1.300 0.000

Gene RIF (9)

PMID Text
24242851 15 nonsynonymous human DNase II SNPs were genotyped in three ethnic groups including 16 different populations using the PCR-restriction fragment length polymorphism technique.
24162774 HIV-1 gp120 upregulates the expression of lysosomal deoxyribonuclease II (DNASE2) in human B cells
23019102 study demonstrated the relationship of genotypes/haplotypes with the in vivo DNase II and promoter activities; significant correlations between genotype in each rheumatoid arthritis (RA)-related SNP and enzymatic activity levels were found; alleles associated with RA exhibited a reduction in serum DNase II activity.
18812394 The association of SNPs in the 5'-regulatory region of the DNA degrading enzyme DNASE2 with Rheumatoid Arthritis implies a role for this enzyme in the pathogenesis of this autoimmune disease.
18812394 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17192590 the enzyme is a monomeric phospholipase D-family member with a pseudodimeric protein fold
15723160 Observational study of gene-disease association. (HuGE Navigator)
12694199 Sp1 and Sp3 are involved in up-regulation of this enzyme's transcriptoin during cell differentiation of hl-60 cells.
12147225 upregulation of expression during myelomonocytic differentiation of HL-60 and THP-1 cells

AA Sequence

MIPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQYKYLDESSGGWRDGRALINS      1 - 70
PEGAVGRSLQPLYRSNTSQLAFLLYNDQPPQPSKAQDSSMRGHTKGVLLLDHDGGFWLVHSVPNFPPPAS     71 - 140
SAAYSWPHSACTYGQTLLCVSFPFAQFSKMGKQLTYTYPWVYNYQLEGIFAQEFPDLENVVKGHHVSQEP    141 - 210
WNSSITLTSQAGAVFQSFAKFSKFGDDLYSGWLAAALGTNLQVQFWHKTVGILPSNCSDIWQVLNVNQIA    211 - 280
FPGPAGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGM    281 - 350
ARKPSRAYKI                                                                351 - 360
//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24242851 2013 Seven nonsynonymous SNPs in the gene encoding human deoxyribonuclease II may serve as a functional SNP potentially implicated in autoimmune dysfunction.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23019102 2012 Genetic and expression analysis of SNPs in the human deoxyribonuclease II: SNPs in the promoter region reduce its in vivo activity through decreased promoter activity.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18812394 2009 Homozygosity for DNASE2 single nucleotide polymorphisms in the 5'-regulatory region is associated with rheumatoid arthritis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...