Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.50
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 3.86753781250039E-5

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.001 0.000

Synonym

Accession O00110
Symbols HOVO3

Gene

  Ortholog (4)

Species Source
Chimp OMA Inparanoid
Mouse OMA Inparanoid
Dog OMA Inparanoid
Opossum OMA Inparanoid

Gene RIF (1)

PMID Text
22737237 Molecular phylogeny of OVOL1, OVOL2 and OVOL3 genes illustrates a conserved C2H2 zinc finger domain coupled by hypervariable unstructured regions in humans and other species

AA Sequence

MPRAFLVRSRRPQPPNWGHLPDQLRGDAYIPGGPLTVPGGKGQERRSVTIWLFSSDCSSLGGPPAQQSSS      1 - 70
VRDPWTAQPTQGNLTSAPRGPGTLGCPLCPKAFPLQRMLTRHLKCHSPVRRHLCRCCGKGFHDAFDLKRH     71 - 140
MRTHTGIRPFRCSACGKAFTQRCSLEAHLAKVHGQPASYAYRERREKLHVCEDCGFTSSRPDTYAQHRAL    141 - 210
HRAA                                                                      211 - 214
//

Text Mined References (3)

PMID Year Title
22737237 2012 Molecular phylogeny of OVOL genes illustrates a conserved C2H2 zinc finger domain coupled by hypervariable unstructured regions.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12213202 2002 Ovol2, a mammalian homolog of Drosophila ovo: gene structure, chromosomal mapping, and aberrant expression in blind-sterile mice.