Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.50
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.001 0.000

Gene RIF (1)

PMID Text
22737237 Molecular phylogeny of OVOL1, OVOL2 and OVOL3 genes illustrates a conserved C2H2 zinc finger domain coupled by hypervariable unstructured regions in humans and other species

AA Sequence

MPRAFLVRSRRPQPPNWGHLPDQLRGDAYIPGGPLTVPGGKGQERRSVTIWLFSSDCSSLGGPPAQQSSS      1 - 70
VRDPWTAQPTQGNLTSAPRGPGTLGCPLCPKAFPLQRMLTRHLKCHSPVRRHLCRCCGKGFHDAFDLKRH     71 - 140
MRTHTGIRPFRCSACGKAFTQRCSLEAHLAKVHGQPASYAYRERREKLHVCEDCGFTSSRPDTYAQHRAL    141 - 210
HRAA                                                                      211 - 214
//

Text Mined References (3)

PMID Year Title
22737237 2012 Molecular phylogeny of OVOL genes illustrates a conserved C2H2 zinc finger domain coupled by hypervariable unstructured regions.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12213202 2002 Ovol2, a mammalian homolog of Drosophila ovo: gene structure, chromosomal mapping, and aberrant expression in blind-sterile mice.