Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
pituitary cancer 1972 3.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.8
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 0.8

Expression

  Differential Expression (1)

Disease log2 FC p
pituitary cancer 1.200 3.0e-03

Synonym

Accession Q9P242 A2RRN4 Q96NL2
Symbols KIAA1486

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MISSKMMSSNPEEDPLDTFLQYIEDMGMKAYDGLVIQNASDIARENDRLRNETNLAYLKEKNEKRRRQEE      1 - 70
AIKRIGGEVGRGHEGSYVGKHFRMGFMTMPAPQDRLPHPCSSGFSVRSQSLHSVGGTDDDSSCGSRRQPP     71 - 140
PKPKRDPSTKLSTSSETVSSTAASKSGKTPERTEASAKPRPHSDEYSKKIPPPKPKRNPNTQLSTSFDET    141 - 210
YIKKHGPRRTSLPRDSSLSQMGSPAGDPEEEEPVYIEMVGNILRDFRKEDDDQSEAVYEEMKYPIFDDLG    211 - 280
QDAKCDFDHHSCSSQCATPTVPDLDFAKASVPCPPKGLLCDIPPPFPNLLSHRPPLLVFPPAPVHCSPNS    281 - 350
DESPLTPLEVTKLPVLENVSYMKQPAGASPSTLPSHVPGHAKLEKEQAAALGPASATPALSSSPPPPSTL    351 - 420
YRTQSPHGYPKSHSTSPSPVSMGRSLTPLSLKRPPPYDAVHSGSLSRSSPSVPHSTPRPVSQDGAKMVNA    421 - 490
AVNTYGAAPGGSRSRTPTSPLEELTSLFSSGRSLLRKSSSGRRSKEPAEKSTEELKVRSHSTEPLPKLDN    491 - 560
KERGHHGASSSREPVKAQEWDGTPGTPVVTSRLGRCSVSPTLLAGNHSSEPKVSCKLGRSASTSGVPPPS    561 - 630
VTPLRQSSDLQQSQVPSSLANRD                                                   631 - 653
//

Text Mined References (14)

PMID Year Title