Property Summary

NCBI Gene PubMed Count 23
PubMed Score 29.43
PubTator Score 27.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Breast cancer 1.100 7.5e-06
glioblastoma 1.100 4.2e-06
group 3 medulloblastoma 1.600 2.3e-05
hepatocellular carcinoma -1.300 1.9e-06
invasive ductal carcinoma 1.200 2.4e-02
malignant mesothelioma 1.800 2.2e-07
medulloblastoma, large-cell 1.100 2.6e-04
non primary Sjogren syndrome sicca 1.300 1.7e-02
pancreatic cancer 1.100 5.8e-03
primary pancreatic ductal adenocarcinoma 1.057 1.3e-02
primitive neuroectodermal tumor 1.100 3.0e-04

 GO Function (1)

Gene RIF (2)

AA Sequence

MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEF      1 - 70
QISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS     71 - 140
//

Text Mined References (25)

PMID Year Title