Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.20
PubTator Score 0.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 8.7e-21
Breast cancer 3578 2.9e-07
Disease Target Count Z-score Confidence
Retinitis Pigmentosa 226 3.992 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer -1.700 2.9e-07
psoriasis -1.800 8.7e-21

Gene RIF (2)

AA Sequence

MVDILGERHLVTCKGATVEAEAALQNKVVALYFAAARCAPSRDFTPLLCDFYTALVAEARRPAPFEVVFV      1 - 70
SADGSSQEMLDFMRELHGAWLALPFHDPYRHELRKRYNVTAIPKLVIVKQNGEVITNKGRKQIRERGLAC     71 - 140
FQDWVEAADIFQNFSV                                                          141 - 156
//

Text Mined References (7)

PMID Year Title