Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.20
PubTator Score 0.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 8.7e-21
Breast cancer 3098 2.9e-07
Disease Target Count Z-score Confidence
Retinitis pigmentosa 156 4.14 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer -1.700 2.9e-07
psoriasis -1.800 8.7e-21

Synonym

Accession Q5VZ03 B1AMD0 Q8TBG6
Symbols RDCVF2
C9orf121

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
20949100 regulation of the Nucleoredoxin-like genes involves a CRX responsive element that can act as both as a positive regulator of promoter activity and as a modulator of cell-type specificity
18854154 Knockdown of nucleoredoxin-like 2 (NXNL2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MVDILGERHLVTCKGATVEAEAALQNKVVALYFAAARCAPSRDFTPLLCDFYTALVAEARRPAPFEVVFV      1 - 70
SADGSSQEMLDFMRELHGAWLALPFHDPYRHELRKRYNVTAIPKLVIVKQNGEVITNKGRKQIRERGLAC     71 - 140
FQDWVEAADIFQNFSV                                                          141 - 156
//

Text Mined References (5)

PMID Year Title
20949100 2010 Expression of rod-derived cone viability factor: dual role of CRX in regulating promoter activity and cell-type specificity.
17764561 2007 Rod-derived Cone Viability Factor-2 is a novel bifunctional-thioredoxin-like protein with therapeutic potential.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.