Property Summary

NCBI Gene PubMed Count 13
PubMed Score 323.42
PubTator Score 17.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
esophageal adenocarcinoma -1.100 3.3e-02
cystic fibrosis -1.706 1.8e-06
atypical teratoid / rhabdoid tumor 1.700 2.3e-03
intraductal papillary-mucinous adenoma (... -2.900 6.6e-06
intraductal papillary-mucinous carcinoma... -3.400 1.8e-03
intraductal papillary-mucinous neoplasm ... -2.300 8.1e-04
lung cancer -3.800 6.3e-05
colon cancer -1.400 1.3e-02
diabetes mellitus -1.100 1.6e-03
group 3 medulloblastoma 2.000 1.3e-05
lung carcinoma -1.400 8.7e-23
spina bifida -1.695 3.6e-02
Breast cancer -1.300 2.4e-04
ovarian cancer 2.300 1.5e-04

Pathway (1)

Gene RIF (3)

PMID Text
21251912 identified nucleoredoxin as an interaction partner of Sec63; characterized this interaction; Sec63 is linked to the Wnt signaling pathways and this interaction may be the reason why mutations in SEC63 can lead to polycystic liver disease
19308021 Observational study of gene-disease association. (HuGE Navigator)
17567240 Nucleoredoxin is a novel thioredoxin family member involved in cell growth and differentiation [review]

AA Sequence

MSGFLEELLGEKLVTGGGEEVDVHSLGARGISLLGLYFGCSLSAPCAQLSASLAAFYGRLRGDAAAGPGP      1 - 70
GAGAGAAAEPEPRRRLEIVFVSSDQDQRQWQDFVRDMPWLALPYKEKHRKLKLWNKYRISNIPSLIFLDA     71 - 140
TTGKVVCRNGLLVIRDDPEGLEFPWGPKPFREVIAGPLLRNNGQSLESSSLEGSHVGVYFSAHWCPPCRS    141 - 210
LTRVLVESYRKIKEAGQNFEIIFVSADRSEESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIM    211 - 280
LDPQGEVITRQGRVEVLNDEDCREFPWHPKPVLELSDSNAAQLNEGPCLVLFVDSEDDGESEAAKQLIQP    281 - 350
IAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVEA    351 - 420
FVNDFLAEKLKPEPI                                                           421 - 435
//

Text Mined References (18)

PMID Year Title
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23300278 2013 Genome-wide association study identifies a novel locus contributing to type 2 diabetes susceptibility in Sikhs of Punjabi origin from India.
22566634 2012 The genetic architecture of economic and political preferences.
21269460 2011 Initial characterization of the human central proteome.
21251912 2011 An interaction between human Sec63 and nucleoredoxin may provide the missing link between the SEC63 gene and polycystic liver disease.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19308021 2009 Findings from bipolar disorder genome-wide association studies replicate in a Finnish bipolar family-cohort.
17567240 2007 Nucleoredoxin, a novel thioredoxin family member involved in cell growth and differentiation.
16764867 2006 Interaction of nucleoredoxin with protein phosphatase 2A.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10903915 2000 Nucleoredoxin, glutaredoxin, and thioredoxin differentially regulate NF-kappaB, AP-1, and CREB activation in HEK293 cells.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9119370 1997 Cloning and characterization of the nucleoredoxin gene that encodes a novel nuclear protein related to thioredoxin.