Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.97
PubTator Score 7.41

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -3.131 6.9e-05
active ulcerative colitis 2.886 2.4e-02
lung adenocarcinoma -1.500 6.9e-16
lung carcinoma -2.200 4.0e-11
non-small cell lung carcinoma -1.800 6.7e-22
spina bifida -1.111 4.3e-02
mucosa-associated lymphoid tissue lympho... 1.548 2.9e-02

AA Sequence

MSLPSGHTTGHTDQVVQRRARCWDIYQRRFSSRSEPVNPGMHSSSHQQQDGDAAMHGAHMDSPVRYTPYT      1 - 70
ISPYNRKGSFRKQDQTHVNMEREQKPPERRMEGNMPDGTLGSWFKITVPFGIKYNEKWLLNLIQNECSVP     71 - 140
FVPVEFHYENMHASFFVENASIAYALKNVSGKIWDEDNEKISIFVNPAGIPHFVHRELKSEKVEQIKLAM    141 - 210
NQQCDVSQEALDIQRLPFYPDMVNRDTKMASNPRKCMAASLDVHEENIPTVMSAGEMDKWKGIEPGEKCA    211 - 280
DRSPVCTTFSDTSSNINSILELFPKLLCLDGQQSPRATLCGTEAHKRLPTCKGSFFGSEMLKNLVLQFLQ    281 - 350
QYYLIYDSGDRQGLLSAYHDEACFSLSIPFNPEDSAPSSFCKFFKDSRNIKILKDPYLRGELLKHTKLDI    351 - 420
VDSLSALPKTQHDLSSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSSLCIVND    421 - 490
KLFVRDTSHQGTQSALFTLVPTAFSSSVPAFSQEQQKMLPS                                 491 - 531
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19060904 2009 An empirical framework for binary interactome mapping.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11566096 2001 NXF5, a novel member of the nuclear RNA export factor family, is lost in a male patient with a syndromic form of mental retardation.
11545741 2001 Two closely related human nuclear export factors utilize entirely distinct export pathways.
11073998 2000 TAP (NXF1) belongs to a multigene family of putative RNA export factors with a conserved modular architecture.