Property Summary

NCBI Gene PubMed Count 25
PubMed Score 351.55
PubTator Score 295.46

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 2.550 2.7e-09
ovarian cancer 1.100 1.1e-12
psoriasis -1.500 8.0e-10

Gene RIF (21)

PMID Text
26341600 NUT gene rearrangement does not seem to be relevant in primary pulmonary carcinomas or carcinoid tumours of the lung
26220994 discovered that the translocation oncoprotein BRD4-NUT protein occupies approximately 100-200 extremely broad, cell type-specific hyperacetylated domains in the genome
26001144 Authors identified eight cases of primary pulmonary NMC over 4 years and, using a NUT immunohistochemistry screen, retrospectively identified one additional case from 166 consecutive biopsies of lung carcinomas lacking glandular differentiation.
25551299 Thirty-seven (76%) malignant germ cell tumors were NUT positive but staining was usually of weak to moderate intensity and observed in a relatively small proportion of neoplastic cells.
25512383 Data support a model in which BRD4-NUT-stimulated histone hyperacetylation recruits additional BRD4 and interacting partners to support transcriptional activation, which underlies the BRD4-NUT oncogenic mechanism in NMC.
24892275 The clinical, radiographic, and histopathologic features of NUT midline carcinoma are discussed, as well as its management options.
24875858 The involvement of the NSD3 methyltransferase as a component of the NUT fusion protein oncogenic complex identifies a new potential therapeutic target.
24655834 Case Report: NUT midline carcinoma in the nasal cavity with BRD4-NUT-rearrangement.
24185123 Four cases with the expression of P16 in NUT carcinomas with no association with human papillomavirus are being described.
23701453 immunohistochemical study of 21 cases revealed a lack of nuclear expression of NUT by undifferentiated (anaplastic) thyroid carcinomas
23128391 The novel BRD4-NUT fusion in which Exon 15 of BRD4 was fused to Exon 2 of NUT encodes a functional protein that is central to the oncogenic mechanism in these cells.
22777717 Determination of NUT protein expression and gene rearrangement can allow the differentiation of NUT midline carcinoma from upper-respiratory tract poorly differentiated malignant tumors
22425924 Only one thymic carcinoma (2.7% of thymic carcinomas or 0.68% of TETs) was found positive for NUT expression and rearrangement
22301500 Case Reports: 2 pediatric cases of nuclear protein of the testis (NUT) midline carcinoma suggestive of pulmonary origin.
21652721 study provides a novel mechanism by which the BRD4-NUT oncogene perturbs BRD4 functions to block cellular differentiation and to contribute to the oncogenic progression in the highly aggressive NUT midline carcinoma
20871268 NUT gene rearrangement is associated with squamous cell carcinoma of the lung with long time survival.
20676058 Using a patient-derived cell line, the authors show that p300 sequestration into the chromatin-bound BRD4-NUT fusion protein foci is the principal oncogenic mechanism leading to p53 inactivation.
19550370 Some carcinomas of the upper aerodigestive tract have a rearrangement of the nuclear protein of the testis (NUT) gene (NUT midline carcinomas).
18391746 Approximately, 20% of undifferentiated carcinomas of the upper aerodigestive tract not associated with EBV infection were found to have rearrangements of NUT by FISH.
17934517 BRD-NUT fusion proteins contribute to carcinogenesis by associating with chromatin and interfering with epithelial differentiation.
15994877 Wild type Brd4 inhibits G(1) to S progression and we also found that the Brd4-NUT fusion augments the inhibition of progression to S phase compared with wild type Brd4.

AA Sequence

MASDGASALPGPDMSMKPSAAPSPSPALPFLPPTSDPPDHPPREPPPQPIMPSVFSPDNPLMLSAFPSSL      1 - 70
LVTGDGGPCLSGAGAGKVIVKVKTEGGSAEPSQTQNFILTQTALNSTAPGTPCGGLEGPAPPFVTASNVK     71 - 140
TILPSKAVGVSQEGPPGLPPQPPPPVAQLVPIVPLEKAWPGPHGTTGEGGPVATLSKPSLGDRSKISKDV    141 - 210
YENFRQWQRYKALARRHLSQSPDTEALSCFLIPVLRSLARLKPTMTLEEGLPLAVQEWEHTSNFDRMIFY    211 - 280
EMAERFMEFEAEEMQIQNTQLMNGSQGLSPATPLKLDPLGPLASEVCQQPVYIPKKAASKTRAPRRRQRK    281 - 350
AQRPPAPEAPKEIPPEAVKEYVDIMEWLVGTHLATGESDGKQEEEGQQQEEEGMYPDPGLLSYINELCSQ    351 - 420
KVFVSKVEAVIHPQFLADLLSPEKQRDPLALIEELEQEEGLTLAQLVQKRLMALEEEEDAEAPPSFSGAQ    421 - 490
LDSSPSGSVEDEDGDGRLRPSPGLQGAGGAACLGKVSSSGKRAREVHGGQEQALDSPRGMHRDGNTLPSP    491 - 560
SSWDLQPELAAPQGTPGPLGVERRGSGKVINQVSLHQDGHLGGAGPPGHCLVADRTSEALPLCWQGGFQP    561 - 630
ESTPSLDAGLAELAPLQGQGLEKQVLGLQKGQQTGGRGVLPQGKEPLAVPWEGSSGAMWGDDRGTPMAQS    631 - 700
YDQNPSPRAAGERDDVCLSPGVWLSSEMDAVGLELPVQIEEVIESFQVEKCVTEYQEGCQGLGSRGNISL    701 - 770
GPGETLVPGDTESSVIPCGGTVAAAALEKRNYCSLPGPLRANSPPLRSKENQEQSCETVGHPSDLWAEGC    771 - 840
FPLLESGDSTLGSSKETLPPTCQGNLLIMGTEDASSLPEASQEAGSRGNSFSPLLETIEPVNILDVKDDC    841 - 910
GLQLRVSEDTCPLNVHSYDPQGEGRVDPDLSKPKNLAPLQESQESYTTGTPKATSSHQGLGSTLPRRGTR    911 - 980
NAIVPRETSVSKTHRSADRAKGKEKKKKEAEEEDEELSNFAYLLASKLSLSPREHPLSPHHASGGQGSQR    981 - 1050
ASHLLPAGAKGPSKLPYPVAKSGKRALAGGPAPTEKTPHSGAQLGVPREKPLALGVVRPSQPRKRRCDSF   1051 - 1120
VTGRRKKRRRSQ                                                             1121 - 1132
//

Text Mined References (29)

PMID Year Title
26341600 2015 NUT expression in primary lung tumours.
26220994 2015 The oncogenic BRD4-NUT chromatin regulator drives aberrant transcription within large topological domains.
26001144 2015 Primary Pulmonary NUT Midline Carcinoma: Clinical, Radiographic, and Pathologic Characterizations.
25551299 2015 NUT protein immunoreactivity in ovarian germ cell tumours.
25512383 2015 Mechanistic analysis of the role of bromodomain-containing protein 4 (BRD4) in BRD4-NUT oncoprotein-induced transcriptional activation.
25416956 2014 A proteome-scale map of the human interactome network.
24892275 Orbital Involvement by NUT Midline Carcinoma.
24875858 2014 NSD3-NUT fusion oncoprotein in NUT midline carcinoma: implications for a novel oncogenic mechanism.
24655834 2014 A rare Japanese case with a NUT midline carcinoma in the nasal cavity: a case report with immunohistochemical and genetic analyses.
24185123 2014 Expression of P16 in NUT carcinomas with no association with human papillomavirus (HPV).
23701453 2013 NUT protein is not expressed in undifferentiated (anaplastic) thyroid carcinoma.
23128391 2013 Novel BRD4-NUT fusion isoforms increase the pathogenic complexity in NUT midline carcinoma.
22777717 2013 Clinicopathological significance of NUT rearrangements in poorly differentiated malignant tumors of the upper respiratory tract.
22425924 2012 NUT rearrangement is uncommon in human thymic epithelial tumors.
22301500 2012 NUT midline carcinoma: report of 2 cases suggestive of pulmonary origin.
21652721 2011 Perturbation of BRD4 protein function by BRD4-NUT protein abrogates cellular differentiation in NUT midline carcinoma.
20871268 2010 Long-term survival of a patient with squamous cell carcinoma harboring NUT gene rearrangement.
20676058 2010 Oncogenesis by sequestration of CBP/p300 in transcriptionally inactive hyperacetylated chromatin domains.
19550370 2009 Carcinomas of the upper aerodigestive tract with rearrangement of the nuclear protein of the testis (NUT) gene (NUT midline carcinomas).
18391746 2008 NUT rearrangement in undifferentiated carcinomas of the upper aerodigestive tract.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17934517 2008 BRD-NUT oncoproteins: a family of closely related nuclear proteins that block epithelial differentiation and maintain the growth of carcinoma cells.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15994877 2005 Cloned fusion product from a rare t(15;19)(q13.2;p13.1) inhibit S phase in vitro.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12543779 2003 BRD4-NUT fusion oncogene: a novel mechanism in aggressive carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.