Property Summary

NCBI Gene PubMed Count 18
PubMed Score 27.47
PubTator Score 21.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (36)

Gene RIF (9)

PMID Text
26839278 NuSAP governs chromosome oscillation via regulation of Kid, facilitating the Kid-generated polar ejection force. Depletion of NuSAP significantly suppresses the amplitude and velocity of chromosome oscillation.
26554377 NUSAP1 may be a crucial biomarker for oral squamous cell carcinoma. down-regulated NUSAP1 expression suppresses tumor proliferation and also enhances anti-tumor effect of paclitaxel by activating apoptotic pathways.
26485712 High levels of NuSAP1 expression were related to poor disease-free survival, particularly in triple-negative breast cancer.
24521615 A novel association between BRCA1 and NUSAP1 is revealed and a mechanism whereby NUSAP1 is involved in carcinogenesis was elusidated.
23405241 High NUSAP1 expression is associated with cervical cancer.
22349817 NuSAP is a novel biomarker for prostate cancer recurrence after surgery and its overexpression appears to be driven in part by E2F1 activation
22101338 Phosphorylation of NuSAP by Cdk1 is an important mechanism to regulate microtubule dynamics during cell cycle progression.
21782797 Interphase NuSAP-chromatin interaction suggests additional functions for NuSAP, as recently identified for other nuclear spindle assembly factors with a role in gene expression or DNA damage response.
20053754 NuSAP1 is recognized as an immunogenic antigen in 65% of patients with AML following allogeneic HCT and suggests a tumor antigen role.

AA Sequence

MIIPSLEELDSLKYSDLQNLAKSLGLRANLRATKLLKALKGYIKHEARKGNENQDESQTSASSCDETEIQ      1 - 70
ISNQEEAERQPLGHVTKTRRRCKTVRVDPDSQQNHSEIKISNPTEFQNHEKQESQDLRATAKVPSPPDEH     71 - 140
QEAENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAHFKEMESIDQYIERKKKHF    141 - 210
EEHNSMNELKQQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGPASQSTLGLKGSLKRSAISAAKT    211 - 280
GVRFSAATKDNEHKRSLTKTPARKSAHVTVSGGTPKGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTP    281 - 350
VSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQRKKREQ    351 - 420
ERKEKKAKVLGMRRGLILAED                                                     421 - 441
//

Text Mined References (32)

PMID Year Title
26839278 2016 NuSAP governs chromosome oscillation by facilitating the Kid-generated polar ejection force.
26554377 2015 Down-Regulation of Nucleolar and Spindle-Associated Protein 1 (NUSAP1) Expression Suppresses Tumor and Cell Proliferation and Enhances Anti-Tumor Effect of Paclitaxel in Oral Squamous Cell Carcinoma.
26485712 2015 High Levels of Nucleolar Spindle-Associated Protein and Reduced Levels of BRCA1 Expression Predict Poor Prognosis in Triple-Negative Breast Cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24521615 2014 NUSAP1 influences the DNA damage response by controlling BRCA1 protein levels.
23405241 2013 Mitosis is a source of potential markers for screening and survival and therapeutic targets in cervical cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22349817 2013 Increased expression of NuSAP in recurrent prostate cancer is mediated by E2F1.
22101338 2011 Phosphorylation of NuSAP by Cdk1 regulates its interaction with microtubules in mitosis.
21782797 2011 SAP-like domain in nucleolar spindle associated protein mediates mitotic chromosome loading as well as interphase chromatin interaction.
21269460 2011 Initial characterization of the human central proteome.
21130744 2011 ATM-mediated NuSAP phosphorylation induces mitotic arrest.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20053754 2010 Antibodies specifically target AML antigen NuSAP1 after allogeneic bone marrow transplantation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17618083 2007 NuSAP is degraded by APC/C-Cdh1 and its overexpression results in mitotic arrest dependent of its microtubules' affinity.
17276916 2007 A role for NuSAP in linking microtubules to mitotic chromosomes.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12963707 2003 NuSAP, a novel microtubule-associated protein involved in mitotic spindle organization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11483580 2001 Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.