Property Summary

NCBI Gene PubMed Count 19
PubMed Score 28.51
PubTator Score 13.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease 1.032 4.7e-03
Breast cancer 3.100 2.9e-02
Endometriosis -2.057 3.2e-02
ovarian cancer 1.600 7.7e-05
pancreatic ductal adenocarcinoma liver m... -1.790 2.2e-03

 GO Function (1)

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (12)

AA Sequence

MTGLYELVWRVLHALLCLHRTLTSWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPPAVGRNRRHHR      1 - 70
HPRGGSCLAAAHHRMRWRADGRSLEKLPVHMGLVITEVEQEPSFSDIASLVVWCMAVGISYISVYDHQGI     71 - 140
FKRNNSRLMDEILKQQQELLGLDCSKYSPEFANSNDKDDQVLNCHLAVKVLSPEDGKADIVRAAQDFCQL    141 - 210
VAQKQKRPTDLDVDTLASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFSA    211 - 280
LRQYAACEQRLGK                                                             281 - 293
//

Text Mined References (19)

PMID Year Title