Property Summary

NCBI Gene PubMed Count 17
PubMed Score 10.14
PubTator Score 10.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Chronic Obstructive Airway Disease 47
Disease Target Count P-value
Pick disease 1893 3.9e-06
osteosarcoma 7933 2.2e-02
astrocytic glioma 2241 4.6e-02
Disease Target Count Z-score Confidence
ulcerative colitis 2087 0.0 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma 1.200 4.6e-02
osteosarcoma -1.007 2.2e-02
Pick disease -1.400 3.9e-06

Gene RIF (15)

PMID Text
26401039 HIV-1 (NL43) Vpr K27M mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that hCG1-Vpr interaction affects TNF production from HIV-1 infected cells
22250199 NLP1 functions as an accessory factor in CRM1-dependent nuclear protein export
21318276 HIV-1 (NL43) Vpr K27M mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that hCG1-Vpr interaction affects TNF production from HIV-1 infected cells
20487506 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20012529 HIV-1 (NL43) Vpr K27M mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that hCG1-Vpr interaction affects TNF production from HIV-1 infected cells
19458171 HIV-1 (NL43) Vpr K27M mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that hCG1-Vpr interaction affects TNF production from HIV-1 infected cells
19275582 HIV-1 (NL43) Vpr K27M mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that hCG1-Vpr interaction affects TNF production from HIV-1 infected cells
18039376 HIV-1 (NL43) Vpr K27M mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that hCG1-Vpr interaction affects TNF production from HIV-1 infected cells
16120388 HIV-1 (NL43) Vpr K27M mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that hCG1-Vpr interaction affects TNF production from HIV-1 infected cells
12228227 Data show that human nucleoporin CG1 participates in the docking of Vpr at the nuclear envelope, which may contribute to the disruption of the nuclear envelope and to the nuclear import of the viral DNA.
12228227 HIV-1 (NL43) Vpr K27M mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that hCG1-Vpr interaction affects TNF production from HIV-1 infected cells
11691994 HIV-1 (NL43) Vpr K27M mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that hCG1-Vpr interaction affects TNF production from HIV-1 infected cells
10358091 HIV-1 (NL43) Vpr K27M mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that hCG1-Vpr interaction affects TNF production from HIV-1 infected cells
9621063 HIV-1 (NL43) Vpr K27M mutant demonstrates decreased or absent TNF production from MT4C5 cells suggesting that hCG1-Vpr interaction affects TNF production from HIV-1 infected cells

AA Sequence

MAICQFFLQGRCRFGDRCWNEHPGARGAGGGRQQPQQQPSGNNRRGWNTTSQRYSNVIQPSSFSKSTPWG      1 - 70
GSRDQEKPYFSSFDSGASTNRKEGFGLSENPFASLSPDEQKDEKKLLEGIVKDMEVWESSGQWMFSVYSP     71 - 140
VKKKPNISGFTDISPEELRLEYHNFLTSNNLQSYLNSVQRLINQWRNRVNELKSLNISTKVALLSDVKDG    141 - 210
VNQAAPAFGFGSSQAATFMSPGFPVNNSSSDNAQNFSFKTNSGFAAASSGSPAGFGSSPAFGAAASTSSG    211 - 280
ISTSAPAFGFGKPEVTSAASFSFKSPAASSFGSPGFSGLPASLATGPVRAPVAPAFGGGSSVAGFGSPGS    281 - 350
HSHTAFSKPSSDTFGNSSISTSLSASSSIIATDNVLFTPRDKLTVEELEQFQSKKFTLGKIPLKPPPLEL    351 - 420
LNV                                                                       421 - 423
//

Text Mined References (21)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22250199 2012 The nucleoporin-like protein NLP1 (hCG1) promotes CRM1-dependent nuclear protein export.
20487506 2010 A whole genome association study of mother-to-child transmission of HIV in Malawi.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16000379 2005 Interaction between the shuttling mRNA export factor Gle1 and the nucleoporin hCG1: a conserved mechanism in the export of Hsp70 mRNA.
15820316 2005 Molecular cloning and functional characterization of mouse Nxf family gene products.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12228227 2002 Docking of HIV-1 Vpr to the nuclear envelope is mediated by the interaction with the nucleoporin hCG1.
11691994 2001 Dynamic disruptions in nuclear envelope architecture and integrity induced by HIV-1 Vpr.
10610322 1999 The RNA export factor Gle1p is located on the cytoplasmic fibrils of the NPC and physically interacts with the FG-nucleoporin Rip1p, the DEAD-box protein Rat8p/Dbp5p and a new protein Ymr 255p.
10601273 1999 Nuclear import of hepatic glucokinase depends upon glucokinase regulatory protein, whereas export is due to a nuclear export signal sequence in glucokinase.
10358091 1999 A new nucleoporin-like protein interacts with both HIV-1 Rev nuclear export signal and CRM-1.
10228171 1999 The Mex67p-mediated nuclear mRNA export pathway is conserved from yeast to human.
9621063 1998 Interaction of the human immunodeficiency virus type 1 Vpr protein with the nuclear pore complex.
9450185 Refined mapping of a gene for autosomal dominant progressive sensorineural hearing loss (DFNA5) to a 2-cM region, and exclusion of a candidate gene that is expressed in the cochlea.