Property Summary

NCBI Gene PubMed Count 121
PubMed Score 186.27
PubTator Score 152.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.148 7.9e-03
malignant mesothelioma 1.200 1.3e-06
osteosarcoma -1.005 4.1e-04
atypical teratoid / rhabdoid tumor 1.300 3.5e-05
glioblastoma 1.100 4.7e-04
medulloblastoma, large-cell 1.600 4.3e-04
acute quadriplegic myopathy 1.356 4.5e-06
tuberculosis and treatment for 6 months -1.900 1.2e-05
lung cancer -1.300 1.1e-02
group 3 medulloblastoma 1.400 1.9e-02
invasive ductal carcinoma -1.114 1.2e-02
ovarian cancer 1.500 1.8e-04
cystic fibrosis and chronic rhinosinusit... -1.151 2.1e-02

Gene RIF (94)

PMID Text
27031510 Despite the difference in localization, all tested Nup98 chimera provoked morphological alterations in the nuclear envelope (NE), in particular affecting the nuclear lamina and the lamina-associated polypeptide 2alpha.
26740045 The results indicate that highly selective targeting of Nup98-fusion proteins to Hox cluster regions via prebound Crm1 induces the formation of higher order chromatin structures that causes aberrant Hox gene regulation.
26017032 NUP98-HOXA9 expression induces myeloid disease.
25852164 Overall, these results demonstrate a novel role for FOXK1 in regulating the expression of antiviral genes via Nup98, from insects to humans.
25510432 deregulation of the retinoid/rexinoid signaling pathway has a major role and may represent a potential therapeutic target for NUP98-RARG-mediated transformation
24951466 Acute myeloid leukemia can be reproduced in mice by transducing mouse mesenchymal stem cells with the human NUP98-NSD1 fusion and the FLT3-ITD mutated constracts.
24927547 Vesiculoviral matrix (M) protein occupies nucleic acid binding site at nucleoporin pair (Rae1 * Nup98).
24739174 These data reveal an emergent Kap-centric barrier mechanism that may underlie mechanistic and kinetic control in the nuclear pore complex.
24371226 NUP98 oncoproteins predispose myeloid cells to oncogenic transformation or malignant progression by promoting whole chromosome instability.
24051001 Nucleoporins NUP153 and NUP98 bind in vitro assembled HIV-1 CA-NC complexes, suggesting that both nucleoporins bind the HIV-1 core during the early stages of infection
23999921 support to the adoption of screening for NUP98-NSD1 in pediatric AML without otherwise favorable genetic markers
23958061 Data indicate increased levels of reactive oxygen species (ROS) were detected in bone marrow nucleated cells (BMNC) that express CD71 in in NUP98-HOXD13 (NHD13) transgenic mice, a murine model for myelodysplastic syndromes (MDS).
23541576 Nup98 RNA interference significantly suppresses downstream mRNA expression in the ss-catenin pathway, while nuclear galectin-3 binds to ss-catenin to inhibit transcriptional activity.
23531517 NUP98/JARID1A is a novel recurrent genetic abnormality in pediatric AMKL
23523133 The roles of NUP153 and nup98 in the integration and replication of HIV-1 in human Jurkat lymphocytes are reported.
23523133 Nucleoporins NUP153 and NUP98 bind in vitro assembled HIV-1 CA-NC complexes, suggesting that both nucleoporins bind the HIV-1 core during the early stages of infection
23523133 Knockdown of nucleoporin 98kDa (NUP98) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
23468646 This work demonstrates for the first time that NUP98 dynamically associates with the human genome during differentiation, revealing a role of a nuclear pore protein in regulating developmental gene expression programs.
23427268 The repeat domain of Nup98 is substantially more cohesive than repeat domains from other nucleoporins.
23246429 Dominant negative Nup98 fusion proteins disrupt the transcriptional activity of wild-type Nup98 in the nucleoplasm to drive acute myeloid leukemia.
23102701 Nup98 functions as a potential tumor suppressor and regulates posttranscriptional expression of select p53 target genes.
23028327 vesicular stomatitis virus M protein interacted efficiently with Rae1-Nup98 complexes associated with the chromatin fraction of host nuclei, consistent with an effect on host transcription
22945772 Positive NUP98-NSD1 fusion is associated with acute myeloid leukemia.
22929522 NUP98/NSD1 fusions are rare in adult acute myeloid leukemia.
22928108 Nucleoporins NUP153 and NUP98 bind in vitro assembled HIV-1 CA-NC complexes, suggesting that both nucleoporins bind the HIV-1 core during the early stages of infection
22613470 findings show that expression of NUP98-HOXD13 impairs class switch recombination and reduces the antibody-mediated immune response, in addition to its role in leukemia
22509482 Nucleoporins NUP153 and NUP98 bind in vitro assembled HIV-1 CA-NC complexes, suggesting that both nucleoporins bind the HIV-1 core during the early stages of infection
22480613 Human Nup98 intereacted with Nup82 through a reciprocal exchange of loop structures. Strikingly, the same Nup98 groove promiscuously interacted with Nup82 and Nup96 in a mutually excusive fashion.
22103895 The fusion genes combining NUP98 exon 11/12 with PSIP1 exon 8 may be implicated in the pathogenesis of myelodysplastic syndrome (MDS).
22058212 the recurrent NUP98-CCDC28A is an oncogene that induces a rapid and transplantable myeloid neoplasm in recipient mice. They also provide additional evidence for an alternative leukemogenic mechanism for NUP98 oncogenes.
21948299 Structural chromosomal rearrangements of NUP98, primarily balanced translocations and inversions, are associated with wide array of hematopoietic malignancies; NUP98 is known to be fused to at least 28 different partner genes in patients. [REVIEW]
21813447 NUP98/NSD1 identifies a previously unrecognized group of young AML patients, with distinct characteristics and dismal prognosis, for whom new treatment strategies are urgently needed.
21467841 RAE1 transgene may be directly involved in NUP98 fusion-mediated leukemogenesis.
21423673 Nucleoporins NUP153 and NUP98 bind in vitro assembled HIV-1 CA-NC complexes, suggesting that both nucleoporins bind the HIV-1 core during the early stages of infection
21335236 Study identified mitotic phosphorylation of Nup98 as a rate-limiting step in mitotic nuclear pore complexes disassembly.
21328509 Ectopic expression of NA10 (Nup98-HoxA10) augments erythroid differentiation of human embryonic stem cells.
21327100 Nucleoporins NUP153 and NUP98 bind in vitro assembled HIV-1 CA-NC complexes, suggesting that both nucleoporins bind the HIV-1 core during the early stages of infection
20935257 NUP98/RARG gene rearrangement is associated with acute myeloid leukemia.
20861915 results suggest high frequency of cell proliferation gene mutations may contribute to leukemogenesis in NUP98-related leukemia; simultaneous occurrence of FLT3-ITD and WT1 aberrations may have an important role in outcome of NUP98-related leukemia
20558618 characterized a novel recurrent chromosomal aberration, inv(11)(p15q23) in 2 patients with acute myeloid leukemia. This aberration is predicted to result in the expression of a NUP98-MLL fusion protein that is unable to interact with menin.
20554795 Mapping tests further demonstrated that aa 22-53 in the N-terminal region of H5N1 virus NS2 and the glycine-leucine-phenylalanine-glycine (GLFG) repeat domain (aa 1-511) of human Nup98 are crucial for the interaction of these two proteins.
20498086 present the crystal structure of human Rae1 in complex with the Gle2-binding sequence (GLEBS) of Nup98 at 1.65 A resolution. Rae1 forms a seven-bladed beta-propeller with several extensive surface loops.
20339440 NUP98-DDX10 dramatically increases proliferation and results in leukemogenesis.
20237156 Findings suggest new possibilities for misregulation by which Nup98 translocations may contribute to cellular transformation and leukemogenesis.
19828735 Oxidative stress up-regulated the binding of Crm1 to Ran and affected multiple repeat-containing nucleoporins by changing their localization, phosphorylation, O-glycosylation, or interaction with other transport components.
19789179 These results are consistent with a specific proteolysis of Nup98 by 2A protease to prevent de novo mRNA traffic in poliovirus-infected cells.
19696924 effects of NUP98-HOXA9 on gene transcription and cell transformation are mediated by two distinct mechanisms: promoter binding through homeodomain with direct transcriptional activation, and another depending on NUP98 moiety not involving DNA binding
19665070 To our knowledge, this is the first case of t(11;12)(p15;q13) in de novo AML-M4 in association with FLT3 ITD mutation. Coexistence of NUP98-HOXC13 fusion and FLT3 ITD mutation is likely relevant in the process of leukemogenesis
19460752 Knockdown of nucleoporin 98kDa (NUP98) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19454010 Nucleoporins NUP153 and NUP98 bind in vitro assembled HIV-1 CA-NC complexes, suggesting that both nucleoporins bind the HIV-1 core during the early stages of infection
19240061 Observational study of gene-disease association. (HuGE Navigator)
19149559 Nucleoporins NUP153 and NUP98 bind in vitro assembled HIV-1 CA-NC complexes, suggesting that both nucleoporins bind the HIV-1 core during the early stages of infection
19000832 Nup96 levels regulate differential gene expression in a phase-specific manner, setting the stage for proper cell cycle progression.
18854154 Nucleoporins NUP153 and NUP98 bind in vitro assembled HIV-1 CA-NC complexes, suggesting that both nucleoporins bind the HIV-1 core during the early stages of infection
18854154 Knockdown of nucleoporin 98kDa (NUP98) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18604245 Novel evidence of the contributory role of the NUP98 sequence in conferring leukemogenic properties on a partner gene.
18566322 transgenic mice expressing NUP98-HOXD13 (NHD13) fusion gene develop myelodysplastic syndrome, and more than half eventually progress to acute leukemia
18388181 translocation involving nucleoporin 98 (NUP98) fused to the DNA-binding domain of the hematopoietically expressed homeobox gene found in acute myeloid leukemia
18287282 High-resolution crystal structures reveal that three highly conserved residues, Tyr866, Gly867, and Leu868, provide most of the interactions between the autoproteolytic domain and the C-terminal tail of Nup98.
18084320 A new fusion gene NUP98-IQCG identified in an acute T-lymphoid/myeloid leukemia with a t(3;11)(q29q13;p15)del(3)(q29) translocation
18045934 Targeting of interferon-inducible NPC proteins, such as Nup98, may be an additional weapon in the arsenal of poliovirus and perhaps other picornaviruses to overcome host defense mechanisms.
17650673 The antitumor activity of deguelin was related to up-regulating the expression of Nup98 and down-regulating Nup88 protein.
17589499 study shows that NUP98-NSD1 induces acute myeloid leukemia in vivo, sustains self-renewal of myeloid stem cells in vitro, and enforces expression of the HoxA7, HoxA9, HoxA10 and Meis1 proto-oncogenes
17442773 NUP98 is dysregulated in myeloid leukemogenesis [review]
17304248 Nucleoporins NUP153 and NUP98 bind in vitro assembled HIV-1 CA-NC complexes, suggesting that both nucleoporins bind the HIV-1 core during the early stages of infection
17178874 The t(7;11)(p15;p15) translocation, observed in acute myelogenous leukemia and myelodysplastic syndrome, generates a chimeric gene where the 5' portion of the sequence encoding the human nucleoporin NUP98 protein is fused to the 3' region of HOXA9.
16861351 synergism between NUP98-HOX and wt-Flt3 is the result of the ability of Flt3 to increase proliferation of myeloid progenitors blocked in differentiation by NUP98-HOX fusions and, revealing a direct role for wt-Flt3 in the pathobiology of AML.
16286466 Caspases target only Nup93 and Nup96 within the core structure of the nuclear pore complex
15951287 NUP98 has a role in hematopoietic malignancies with 11p15 aberrations
15725483 A novel fusion of the NUP98 and LEDGF genes in a pediatric case of acute myeloid leukemia.
15681849 CYBB is a common target gene repressed by HoxA10 and activated by HoxA9, and Meis1 and Nup98-hoxA9 have roles in repressing myeloid-specific gene transcription
15454493 Dnalc4, Fcgr2b, Fcrl, and Con1 genes cooperated with NUP98-HOXA9 in transforming NIH 3T3 cells.
15359631 Review. The newly identified NUP98 gene, located on chromosome 11p15.5, has been observed fused to 15 different partners. It encodes a 98 kD component of the nuclear pore complex, which mediates nucleo-cytoplasmic transport of protein and RNA.
15207818 Nup98 on the nuclear pore complex specifically participates in the nuclear entry of HIV-1 cDNA following HIV-1 entry.
14966272 Data report novel nucleoporin 98 fusions with homeobox (HOX)A10, HOXB3 and HOXB4, and describe the results of coexpression of these proteins with the Hox cofactor Meis1 in leukemic induction.
14718558 Nup153 and Nup98 have distinct domains to mediate transcription-dependent mobility
14561764 Nup98-HOXA9 has a role in inducing gene transcription in myeloid cells
14554087 Specific and potent interactor of the HIV-1 Rev nuclear export signal. This suggests a physiological role for hNup98 in modulating Rev-dependent RNA export during HIV infection
14554087 Nucleoporins NUP153 and NUP98 bind in vitro assembled HIV-1 CA-NC complexes, suggesting that both nucleoporins bind the HIV-1 core during the early stages of infection
14517296 Sec13 stably interacts with Nup96 at the NPC during interphase and the shuttling of Sec13 between the nucleus and the cytoplasm may couple and regulate functions between these two compartments
12970787 Major form of NUP98/HOXC11 fusion in adult acute myeloid leukemia with t(11;12)(p15;q13) translocation exhibits aberrant trans-regulatory activity
12931227 fused with NSD1 and frequently transcribed in childhool AML
12589057 Nup98 interacts with both faces of the nuclear pore, a localization in keeping with its previously described nucleocytoplasmic shuttling activity
12191480 The three-dimensional structure of the autoproteolytic, nuclear pore-targeting domain of the human nucleoporin Nup98.
12138901 The NUP98/HOXA9 FUSION transcript was detected by PC at exon A and not exon B of NUP98.
12112533 The chromosome translocation t(7;11)(p15;p15) in acute myeloid leukemia results in fusion of the NUP98 gene with cluster gene HOXA13.
12082612 Nup98-HoxA9 immortalizes myeloid progenitors, enforces expression of Hoxa9, Hoxa7 and Meis1, and alters cytokine-specific responses in a manner similar to that induced by retroviral co-expression of Hoxa9 and Meis1.
11950939 Nup98 aids in direction of RNAs to the nuclear pore and provide the first potential mechanism for the role of a mobile nucleoporin.
11830496 the fusion gene NUP98-HOXA9 is an important gene in myeloid leukemogenesis.
11809937 increased Nup98 and Nup96 expression constitutes an IFN-mediated mechanism that reverses M protein-mediated inhibition of gene expression
11782354 The HOXD11 gene is fused to the NUP98 gene in acute myeloid leukemia with t(2;11)(q31;p15).
11238447 Nucleoporins NUP153 and NUP98 bind in vitro assembled HIV-1 CA-NC complexes, suggesting that both nucleoporins bind the HIV-1 core during the early stages of infection
9847314 Nucleoporins NUP153 and NUP98 bind in vitro assembled HIV-1 CA-NC complexes, suggesting that both nucleoporins bind the HIV-1 core during the early stages of infection
8943370 Nucleoporins NUP153 and NUP98 bind in vitro assembled HIV-1 CA-NC complexes, suggesting that both nucleoporins bind the HIV-1 core during the early stages of infection

AA Sequence

MFNKSFGTPFGGGTGGFGTTSTFGQNTGFGTTSGGAFGTSAFGSSNNTGGLFGNSQTKPGGLFGTSSFSQ      1 - 70
PATSTSTGFGFGTSTGTANTLFGTASTGTSLFSSQNNAFAQNKPTGFGNFGTSTSSGGLFGTTNTTSNPF     71 - 140
GSTSGSLFGPSSFTAAPTGTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQA    141 - 210
NRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGFAYGQNKTAFGTSTTGFGTNPGGLFGQQNQQ    211 - 280
TTSLFSKPFGQATTTQNTGFSFGNTSTIGQPSTNTMGLFGVTQASQPGGLFGTATNTSTGTAFGTGTGLF    281 - 350
GQTNTGFGAVGSTLFGNNKLTTFGSSTTSAPSFGTTSGGLFGNKPTLTLGTNTNTSNFGFGTNTSGNSIF    351 - 420
GSKPAPGTLGTGLGAGFGTALGAGQASLFGNNQPKIGGPLGTGAFGAPGFNTTTATLGFGAPQAPVALTD    421 - 490
PNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRV    491 - 560
RPKALQTTGTAKSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPEN    561 - 630
GERFSFLSKPVDENHQQDGDEDSLVSHFYTNPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNG    631 - 700
LEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRK    701 - 770
GYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSP    771 - 840
DRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLP    841 - 910
PASQTTPLQMALNGKPAPPPQSQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHI    911 - 980
ASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKADTSQEICSPRLPISASHSSKTRSLVGGLLQ    981 - 1050
SKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVGTRRQLGLVPR   1051 - 1120
EKSVTYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLT   1121 - 1190
ESPFKVHLEKLSLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDL   1191 - 1260
PEAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSP   1261 - 1330
VEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLVDWHQLQADSFIQDERLRIFA   1331 - 1400
LLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSY   1401 - 1470
LEGSGCVIAEEQNSQTPLRDVCFHLLKLYSDRHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHL   1471 - 1540
SAQCEGVLQASYAGQLESEGLWEWAIFVLLHIDNSGIREKAVRELLTRHCQLLETPESWAKETFLTQKLR   1541 - 1610
VPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERS   1611 - 1680
SLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKDRLAQSDMAKR   1681 - 1750
VANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVGSL      1751 - 1817
//

Text Mined References (139)

PMID Year Title
27031510 2016 Expression of Leukemia-Associated Nup98 Fusion Proteins Generates an Aberrant Nuclear Envelope Phenotype.
26740045 2016 Chromatin-prebound Crm1 recruits Nup98-HoxA9 fusion to induce aberrant expression of Hox cluster genes.
26017032 2015 Epigenetic therapy restores normal hematopoiesis in a zebrafish model of NUP98-HOXA9-induced myeloid disease.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25852164 2015 The transcription factor FoxK participates with Nup98 to regulate antiviral gene expression.
25510432 2015 Critical role of retinoid/rexinoid signaling in mediating transformation and therapeutic response of NUP98-RARG leukemia.
24951466 2014 Potent co-operation between the NUP98-NSD1 fusion and the FLT3-ITD mutation in acute myeloid leukemia induction.
24927547 2014 Vesiculoviral matrix (M) protein occupies nucleic acid binding site at nucleoporin pair (Rae1 • Nup98).
24739174 2014 Karyopherin-centric control of nuclear pores based on molecular occupancy and kinetic analysis of multivalent binding with FG nucleoporins.
24371226 2014 NUP98 fusion oncoproteins promote aneuploidy by attenuating the mitotic spindle checkpoint.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23999921 2013 NUP98-NSD1 fusion in association with FLT3-ITD mutation identifies a prognostically relevant subgroup of pediatric acute myeloid leukemia patients suitable for monitoring by real time quantitative PCR.
23958061 2014 Oxidative stress leads to increased mutation frequency in a murine model of myelodysplastic syndrome.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23541576 2013 Nucleoporin Nup98 mediates galectin-3 nuclear-cytoplasmic trafficking.
23531517 2013 NUP98/JARID1A is a novel recurrent abnormality in pediatric acute megakaryoblastic leukemia with a distinct HOX gene expression pattern.
23523133 2013 Nup153 and Nup98 bind the HIV-1 core and contribute to the early steps of HIV-1 replication.
23468646 2013 Dynamic association of NUP98 with the human genome.
23427268 2013 In vivo analysis of human nucleoporin repeat domain interactions.
23246429 2013 The role of Nup98 in transcription regulation in healthy and diseased cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23102701 2012 Nuclear pore component Nup98 is a potential tumor suppressor and regulates posttranscriptional expression of select p53 target genes.
23028327 2012 Complexes of vesicular stomatitis virus matrix protein with host Rae1 and Nup98 involved in inhibition of host transcription.
22945772 2013 A rare but specific subset of adult AML patients can be defined by the cytogenetically cryptic NUP98-NSD1 fusion gene.
22929522 2013 Analysis of NUP98/NSD1 translocations in adult AML and MDS patients.
22613470 2012 A NUP98-HOXD13 leukemic fusion gene leads to impaired class switch recombination and antibody production.
22480613 2012 Molecular basis for the anchoring of proto-oncoprotein Nup98 to the cytoplasmic face of the nuclear pore complex.
22334672 2012 Herpes simplex virus ICP27 protein directly interacts with the nuclear pore complex through Nup62, inhibiting host nucleocytoplasmic transport pathways.
22103895 2012 Expression of the novel NUP98/PSIP1 fusion transcripts in myelodysplastic syndrome with t(9;11)(p22;p15).
22058212 2012 Functional analysis of the NUP98-CCDC28A fusion protein.
21948299 2011 NUP98 gene fusions and hematopoietic malignancies: common themes and new biologic insights.
21813447 2011 NUP98/NSD1 characterizes a novel poor prognostic group in acute myeloid leukemia with a distinct HOX gene expression pattern.
21467841 2011 RNA export factor RAE1 contributes to NUP98-HOXA9-mediated leukemogenesis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21335236 2011 Phosphorylation of Nup98 by multiple kinases is crucial for NPC disassembly during mitotic entry.
21328509 2011 Brief report: ectopic expression of NUP98-HOXA10 augments erythroid differentiation of human embryonic stem cells.
21269460 2011 Initial characterization of the human central proteome.
20935257 2011 A novel NUP98/RARG gene fusion in acute myeloid leukemia resembling acute promyelocytic leukemia.
20861915 2010 High frequencies of simultaneous FLT3-ITD, WT1 and KIT mutations in hematological malignancies with NUP98-fusion genes.
20558618 2010 NUP98-MLL fusion in human acute myeloblastic leukemia.
20554795 2010 Human cellular protein nucleoporin hNup98 interacts with influenza A virus NS2/nuclear export protein and overexpression of its GLFG repeat domain can inhibit virus propagation.
20545767 2010 Nucleoporin Nup98: a gatekeeper in the eukaryotic kingdoms.
20498086 2010 Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1.
20407419 2010 Protein Tpr is required for establishing nuclear pore-associated zones of heterochromatin exclusion.
20339440 2010 Effects of the NUP98-DDX10 oncogene on primary human CD34+ cells: role of a conserved helicase motif.
20237156 2010 Nup98-homeodomain fusions interact with endogenous Nup98 during interphase and localize to kinetochores and chromosome arms during mitosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19828735 2009 Oxidative stress inhibits nuclear protein export by multiple mechanisms that target FG nucleoporins and Crm1.
19789179 2009 RNA nuclear export is blocked by poliovirus 2A protease and is concomitant with nucleoporin cleavage.
19696924 2009 Dissection of the transformation of primary human hematopoietic cells by the oncogene NUP98-HOXA9.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19665070 2009 Acute myeloid leukemia with NUP98-HOXC13 fusion and FLT3 internal tandem duplication mutation: case report and literature review.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19000832 2008 Nucleoporin levels regulate cell cycle progression and phase-specific gene expression.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18604245 2008 Leukemogenic properties of NUP98-PMX1 are linked to NUP98 and homeodomain sequence functions but not to binding properties of PMX1 to serum response factor.
18566322 2008 Leukemic transformation in mice expressing a NUP98-HOXD13 transgene is accompanied by spontaneous mutations in Nras, Kras, and Cbl.
18388181 2008 Leukemogenic mechanisms and targets of a NUP98/HHEX fusion in acute myeloid leukemia.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18287282 2008 Structural constraints on autoprocessing of the human nucleoporin Nup98.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18084320 2008 A new fusion gene NUP98-IQCG identified in an acute T-lymphoid/myeloid leukemia with a t(3;11)(q29q13;p15)del(3)(q29) translocation.
18045934 2008 Differential targeting of nuclear pore complex proteins in poliovirus-infected cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17650673 2007 [Deguelin regulates cell cycle and nuclear pore complex protein Nup98 and Nup88 in U937 cells in vitro].
17589499 2007 NUP98-NSD1 links H3K36 methylation to Hox-A gene activation and leukaemogenesis.
17442773 2007 NUP98 dysregulation in myeloid leukemogenesis.
17360435 2007 Cell-cycle-dependent phosphorylation of the nuclear pore Nup107-160 subcomplex.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17287853 2007 A novel NUP98-PHF23 fusion resulting from a cryptic translocation t(11;17)(p15;p13) in acute myeloid leukemia.
17178874 2006 Enforced expression of NUP98-HOXA9 in human CD34(+) cells enhances stem cell proliferation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16861351 2006 The Flt3 receptor tyrosine kinase collaborates with NUP98-HOX fusions in acute myeloid leukemia.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16467868 2006 NUP98 rearrangements in hematopoietic malignancies: a study of the Groupe Francophone de Cytogénétique Hématologique.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16286466 2006 Caspases target only two architectural components within the core structure of the nuclear pore complex.
16028218 2005 Characterization of 6q abnormalities in childhood acute myeloid leukemia and identification of a novel t(6;11)(q24.1;p15.5) resulting in a NUP98-C6orf80 fusion in a case of acute megakaryoblastic leukemia.
15951287 2005 Screening for NUP98 rearrangements in hematopoietic malignancies by fluorescence in situ hybridization.
15725483 2005 t(9;11)(p22;p15) with NUP98-LEDGF fusion gene in pediatric acute myeloid leukemia.
15681849 2005 HOXA9 activates transcription of the gene encoding gp91Phox during myeloid differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15454493 2005 Identification of cooperative genes for NUP98-HOXA9 in myeloid leukemogenesis using a mouse model.
15359631 2004 The role of NUP98 gene fusions in hematologic malignancy.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15229283 2004 Nucleoporins as components of the nuclear pore complex core structure and Tpr as the architectural element of the nuclear basket.
15207818 2004 Role of Nup98 in nuclear entry of human immunodeficiency virus type 1 cDNA.
15146057 2004 The entire Nup107-160 complex, including three new members, is targeted as one entity to kinetochores in mitosis.
14966272 2004 Differential and common leukemogenic potentials of multiple NUP98-Hox fusion proteins alone or with Meis1.
14718558 2004 Distinct functional domains within nucleoporins Nup153 and Nup98 mediate transcription-dependent mobility.
14561764 2004 The oncogene Nup98-HOXA9 induces gene transcription in myeloid cells.
14554087 2003 Functional analysis of the interaction of the human immunodeficiency virus type 1 Rev nuclear export signal with its cofactors.
14517296 2003 Sec13 shuttles between the nucleus and the cytoplasm and stably interacts with Nup96 at the nuclear pore complex.
12970787 2003 Major form of NUP98/HOXC11 fusion in adult AML with t(11;12)(p15;q13) translocation exhibits aberrant trans-regulatory activity.
12931227 2003 Frequency of NUP98-NSD1 fusion transcript in childhood acute myeloid leukaemia.
12802065 2003 Direct interaction with nup153 mediates binding of Tpr to the periphery of the nuclear pore complex.
12589057 2003 Nup98 localizes to both nuclear and cytoplasmic sides of the nuclear pore and binds to two distinct nucleoporin subcomplexes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12228227 2002 Docking of HIV-1 Vpr to the nuclear envelope is mediated by the interaction with the nucleoporin hCG1.
12191480 2002 The three-dimensional structure of the autoproteolytic, nuclear pore-targeting domain of the human nucleoporin Nup98.
12138901 2002 A case of acute myeloid leukemia with t(7;11)(p15;p15) mimicking myeloid crisis of chronic myelogenous leukemia.
12112533 2002 The chromosome translocation t(7;11)(p15;p15) in acute myeloid leukemia results in fusion of the NUP98 gene with a HOXA cluster gene, HOXA13, but not HOXA9.
12082612 2002 Nup98-HoxA9 immortalizes myeloid progenitors, enforces expression of Hoxa9, Hoxa7 and Meis1, and alters cytokine-specific responses in a manner similar to that induced by retroviral co-expression of Hoxa9 and Meis1.
11986249 2002 NUP98 is fused to the NSD3 gene in acute myeloid leukemia associated with t(8;11)(p11.2;p15).
11950939 2002 Nup98 is a mobile nucleoporin with transcription-dependent dynamics.
11839768 2002 Tpr is localized within the nuclear basket of the pore complex and has a role in nuclear protein export.
11830496 2002 Single-translocation and double-chimeric transcripts: detection of NUP98-HOXA9 in myeloid leukemias with HOXA11 or HOXA13 breaks of the chromosomal translocation t(7;11)(p15;p15).
11809937 2002 Role of nucleoporin induction in releasing an mRNA nuclear export block.
11782354 2002 The HOXD11 gene is fused to the NUP98 gene in acute myeloid leukemia with t(2;11)(q31;p15).
11684705 2001 Novel vertebrate nucleoporins Nup133 and Nup160 play a role in mRNA export.
11564755 2001 An evolutionarily conserved NPC subcomplex, which redistributes in part to kinetochores in mammalian cells.
11493482 2001 A novel gene, NSD1, is fused to NUP98 in the t(5;11)(q35;p15.5) in de novo childhood acute myeloid leukemia.
11248057 2001 The nucleoporin Nup98 associates with the intranuclear filamentous protein network of TPR.
11238447 2001 Cofactor requirements for nuclear export of Rev response element (RRE)- and constitutive transport element (CTE)-containing retroviral RNAs. An unexpected role for actin.
11106761 2000 Vesicular stomatitis virus matrix protein inhibits host cell gene expression by targeting the nucleoporin Nup98.
10875935 2000 The nucleoporin Nup98 is a site for GDP/GTP exchange on ran and termination of karyopherin beta 2-mediated nuclear import.
10668806 2000 The C-terminal domain of TAP interacts with the nuclear pore complex and promotes export of specific CTE-bearing RNA substrates.
10601273 1999 Nuclear import of hepatic glucokinase depends upon glucokinase regulatory protein, whereas export is due to a nuclear export signal sequence in glucokinase.
10556215 1999 The t(11;20)(p15;q11) chromosomal translocation associated with therapy-related myelodysplastic syndrome results in an NUP98-TOP1 fusion.
10500183 1999 Autoproteolysis in nucleoporin biogenesis.
10209021 1999 RAE1 is a shuttling mRNA export factor that binds to a GLEBS-like NUP98 motif at the nuclear pore complex through multiple domains.
10087256 1999 A conserved biogenesis pathway for nucleoporins: proteolytic processing of a 186-kilodalton precursor generates Nup98 and the novel nucleoporin, Nup96.
9858599 1999 CREB binding protein interacts with nucleoporin-specific FG repeats that activate transcription and mediate NUP98-HOXA9 oncogenicity.
9847314 1999 Nucleoporins nup98 and nup214 participate in nuclear export of human immunodeficiency virus type 1 Rev.
9348540 1997 Nup93, a vertebrate homologue of yeast Nic96p, forms a complex with a novel 205-kDa protein and is required for correct nuclear pore assembly.
9166830 1997 The inv(11)(p15q22) chromosome translocation of de novo and therapy-related myeloid malignancies results in fusion of the nucleoporin gene, NUP98, with the putative RNA helicase gene, DDX10.
9144189 1997 Karyopherin beta2 mediates nuclear import of a mRNA binding protein.
9114010 1997 Cloning and characterization of human karyopherin beta3.
8943370 1996 A role for nucleoporin FG repeat domains in export of human immunodeficiency virus type 1 Rev protein and RNA from the nucleus.
8707840 1996 Molecular and functional characterization of the p62 complex, an assembly of nuclear pore complex glycoproteins.
8563754 1996 The t(7;11)(p15;p15) translocation in acute myeloid leukaemia fuses the genes for nucleoporin NUP98 and class I homeoprotein HOXA9.
8563753 1996 Fusion of the nucleoporin gene NUP98 to HOXA9 by the chromosome translocation t(7;11)(p15;p15) in human myeloid leukaemia.
7736573 1995 The peptide repeat domain of nucleoporin Nup98 functions as a docking site in transport across the nuclear pore complex.