Property Summary

NCBI Gene PubMed Count 35
PubMed Score 30.67
PubTator Score 35.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.563 9.2e-06
group 3 medulloblastoma 1.800 1.7e-05
medulloblastoma, large-cell 1.200 5.2e-04
primitive neuroectodermal tumor 1.200 7.6e-04
juvenile dermatomyositis 1.059 6.2e-07
acute quadriplegic myopathy 1.392 1.4e-07
lung cancer 1.500 9.1e-03
Breast cancer -1.100 4.7e-23
ovarian cancer 2.800 2.8e-06
dermatomyositis 1.400 1.5e-03

 GO Function (1)

Gene RIF (17)

PMID Text
26731471 These findings demonstrate that the NUP88-NUP98-RAE1-APC/CCDH1 axis contributes to aneuploidy
23777819 Nup62 and Nup88 protein levels were significantly decreased upon knockdown of O-GlcNAc transferase.
21896994 Nup88 mRNA was overexpressed in colorectal cancers and the overexpression was associated with cancer development and aggressiveness.
21863385 Serum Nup88 might be a candidate for a new biomarker implicated in the development and aggressiveness of colorectal cancer
21289091 Data suggest that a pool of Nup88 on the nuclear side of the nuclear pore complex provides a novel, unexpected binding site for nuclear lamin A.
20973273 association found between myometrial invasion and Nup88 expression in endometrial carcinoma
20497554 proper expression of Nup88 is critical for preventing aneuploidy formation and tumorigenesis.
19751906 Nup88 is significantly overexpressed in high-grade CIN lesions and ISCC compared with normal ectocervical squamous epithelia and CIN1.
19454010 Interaction of HIV-1 Tat with Nup88 in T-cells is identified by a proteomic strategy based on affinity chromatography
18606815 Nup88 is up-regulated in response to hypertonic stress and acts to retain TonEBP in the nucleus, activating transcription of critical osmoprotective genes.
18068677 The formation of high molecular mass complexes containing importin-alpha, Nup153 and Nup88 is increased upon oxidant treatment.
17828493 Gambogic acid exerts its anti-leukemia effects by regulating the expression and distribution of nucleoporin Nup88.
17650673 The antitumor activity of deguelin was related to up-regulating the expression of Nup98 and down-regulating Nup88 protein.
17007055 Our data strongly indicate a dichotomous role for Nup88 in non-neoplastic and neoplastic conditions of the liver.
16675447 the Nup214-Nup88 nucleoporin subcomplex is required for CRM1-mediated 60 S preribosomal nuclear export
15300515 A monoclonal antibody for Nup88 in an experimental model for studying the role played by Nup88 during cell development and differentiation.
14999780 High Nup88 mRNA expression levels correlated with ductal and tubular histology, nuclear grade 3, absence of hormone receptors, expression of c-erb-B2 oncogene and mutant p53 protein, high proliferation, DNA aneuploidy, and axillary node invasion.

AA Sequence

MAAAEGPVGDGELWQTWLPNHVVFLRLREGLKNQSPTEAEKPASSSLPSSPPPQLLTRNVVFGLGGELFL      1 - 70
WDGEDSSFLVVRLRGPSGGGEEPALSQYQRLLCINPPLFEIYQVLLSPTQHHVALIGIKGLMVLELPKRW     71 - 140
GKNSEFEGGKSTVNCSTTPVAERFFTSSTSLTLKHAAWYPSEILDPHVVLLTSDNVIRIYSLREPQTPTN    141 - 210
VIILSEAEEESLVLNKGRAYTASLGETAVAFDFGPLAAVPKTLFGQNGKDEVVAYPLYILYENGETFLTY    211 - 280
ISLLHSPGNIGKLLGPLPMHPAAEDNYGYDACAVLCLPCVPNILVIATESGMLYHCVVLEGEEEDDHTSE    281 - 350
KSWDSRIDLIPSLYVFECVELELALKLASGEDDPFDSDFSCPVKLHRDPKCPSRYHCTHEAGVHSVGLTW    351 - 420
IHKLHKFLGSDEEDKDSLQELSTEQKCFVEHILCTKPLPCRQPAPIRGFWIVPDILGPTMICITSTYECL    421 - 490
IWPLLSTVHPASPPLLCTREDVEVAESPLRVLAETPDSFEKHIRSILQRSVANPAFLKASEKDIAPPPEE    491 - 560
CLQLLSRATQVFREQYILKQDLAKEEIQRRVKLLCDQKKKQLEDLSYCREERKSLREMAERLADKYEEAK    561 - 630
EKQEDIMNRMKKLLHSFHSELPVLSDSERDMKKELQLIPDQLRHLGNAIKQVTMKKDYQQQKMEKVLSLP    631 - 700
KPTIILSAYQRKCIQSILKEEGEHIREMVKQINDIRNHVNF                                 701 - 741
//

Text Mined References (45)

PMID Year Title
26731471 2016 Nuclear pore protein NUP88 activates anaphase-promoting complex to promote aneuploidy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23777819 2013 Quantitative regulation of nuclear pore complex proteins by O-GlcNAcylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21896994 Nup88 mRNA overexpression in colorectal cancers and relationship with p53.
21863385 2012 Increased serum level of Nup88 protein is associated with the development of colorectal cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21289091 2011 The nucleoporin Nup88 is interacting with nuclear lamin A.
21269460 2011 Initial characterization of the human central proteome.
20973273 2010 Nup88 expression is associated with myometrial invasion in endometrial carcinoma.
20497554 2010 Characterization of the role of the tumor marker Nup88 in mitosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19751906 2009 Nucleoporin 88 expression in normal and neoplastic squamous epithelia of the uterine cervix.
19700630 2009 Nuclear pore complex component MOS7/Nup88 is required for innate immunity and nuclear accumulation of defense regulators in Arabidopsis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18606815 2008 Nucleoporin 88 (Nup88) is regulated by hypertonic stress in kidney cells to retain the transcription factor tonicity enhancer-binding protein (TonEBP) in the nucleus.
18068677 2008 Oxidative stress mislocalizes and retains transport factor importin-alpha and nucleoporins Nup153 and Nup88 in nuclei where they generate high molecular mass complexes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17828493 2007 Effects of gambogic acid on the regulation of nucleoporin Nup88 in U937 cells.
17650673 2007 [Deguelin regulates cell cycle and nuclear pore complex protein Nup98 and Nup88 in U937 cells in vitro].
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17007055 2006 Nucleoporin 88 expression in hepatitis B and C virus-related liver diseases.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16675447 2006 Nup214-Nup88 nucleoporin subcomplex is required for CRM1-mediated 60 S preribosomal nuclear export.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15300515 2004 Developing chick embryos express a protein which shares homology with the nuclear pore complex protein Nup88 present in human tumors.
14999780 2004 Nup88 mRNA overexpression is associated with high aggressiveness of breast cancer.
12589057 2003 Nup98 localizes to both nuclear and cytoplasmic sides of the nuclear pore and binds to two distinct nucleoporin subcomplexes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12228227 2002 Docking of HIV-1 Vpr to the nuclear envelope is mediated by the interaction with the nucleoporin hCG1.
12094380 2002 Nup88 (karyoporin) in human malignant neoplasms and dysplasias: correlations of immunostaining of tissue sections, cytologic smears, and immunoblot analysis.
11248054 2001 Disruption of the FG nucleoporin NUP98 causes selective changes in nuclear pore complex stoichiometry and function.
11073820 2000 A novel, nuclear pore-associated, widely distributed molecule overexpressed in oncogenesis and development.
10967423 2000 Diverse nuclear transport pathways regulate cell proliferation and oncogenesis.
10601273 1999 Nuclear import of hepatic glucokinase depends upon glucokinase regulatory protein, whereas export is due to a nuclear export signal sequence in glucokinase.
10554006 1999 The nuclear pore complex protein Nup88 is overexpressed in tumor cells.
10395558 1999 The nuclear pore complex: from molecular architecture to functional dynamics.
9488438 1998 Overexpression of the nucleoporin CAN/NUP214 induces growth arrest, nucleocytoplasmic transport defects, and apoptosis.
9205132 1997 Chromosomal localization of genes encoding CAN/Nup214-interacting proteins--human CRM1 localizes to 2p16, whereas Nup88 localizes to 17p13 and is physically linked to SF2p32.
9049309 1997 The human homologue of yeast CRM1 is in a dynamic subcomplex with CAN/Nup214 and a novel nuclear pore component Nup88.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.