1. Home
  2. Targets
  3. Nucleoporin Nup43

Tdark Nucleoporin Nup43

Component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.

Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes (NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP43 is part of one such subcomplex, Nup107-160 (Loiodice et al., 2004 [PubMed 15146057]).[supplied by OMIM, Mar 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.06
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.200 5.8e-06
psoriasis -1.100 1.4e-06
osteosarcoma 1.789 2.5e-04
pancreatic ductal adenocarcinoma liver m... 1.407 2.1e-02
lung cancer 2.000 2.2e-05
group 3 medulloblastoma 1.400 2.4e-03
ovarian cancer -1.200 7.6e-05
dermatomyositis 1.100 2.9e-04

Synonym

Accession Q8NFH3 B4E2F0 Q9H8S0
Symbols p42
bA350J20.1

Gene

NUP43

PDB

5A9Q   4I79  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (20)

See all...

 GO Component (4)

 GO Process (14)

See all...

 Compartment GO Term (34)

See all...

 HCA RNA Cell Line (56)

See all...

Pathway (73)

See all...

Protein-protein Interaction (207)

POM121C   DDX39A   IGF2BP3   NDC80   XPO1   IPO8   NUPL2   POLR2D   ZW10   XPOT   BUB1   RAD21   CDC40   BUB1B   DIAPH2   CLASP2   ZC3H11A   PSIP1   NUP155   CCNB2   ZWINT   SLU7   CDK1   EIF4E   NPM1   EPRS   HNRNPC   HSPA1B   HSPA1B   TOP2A   PABPC1   TPR   CCNB1   HMGA1   POLR2C   POLR2E   SP100   EIF4B   POLR2A   U2AF2   ZFP36   PML   CLIP1   POLR2B   GCK   PPP1CC   POLR2I   NUP62   RPS27   RANBP1   RANGAP1   CENPF   RANBP2   KNTC1   POLR2H   POLR2J   NUP98   PLK1   POLR2K   SEC13   SUMO3   EIF4A1   CDC42   POLR2F   SUMO2   POLR2G   HIST2H4A   RAN   POLR2L   SUMO1   UBE2I   HIST1H3F   RAE1   SRSF3   H3F3B   U2AF1   SRSF2   CENPE   EIF4G1   SRSF11   ZFP36L1   SRSF1   SRSF4   CDC20   SRSF9   SRSF5   SRSF6   MAD2L1   ITGB3BP   HNRNPD   EIF4A2   SMC1A   RNPS1   SRSF7   PDS5A   ERCC6L   CTU2   PAN2   HIKESHI   CDCA8   SGO2   PAN3   SGO1   NUP188   THOC7   CENPP   PMF1   HIST2H3D   CENPU   CENPQ   TAOK1   NUP54   CLASP1   TRMT11   WAPL   CTU1   ALYREF   THOC6   SRRM1   TRMT44   CENPL   NUP93   CENPS   STAG2   KIF2B   SPC24   NUP35   KNL1   THOC2   KIF18A   NEK9   NSUN6   NUP210   U2AF1L4   NUP133   SKA2   STAG1   AHCTF1   DHX38   NUP205   KHSRP   MAGOHB   SKA1   CENPT   ALKBH8   SPDL1   SEH1L   CDCA5   THOC1   AURKB   CENPN   POM121   NSL1   THOC3   NUP88   B9D2   CENPK   URM1   NDC1   CENPO   NUP58   NUP85   QTRT1   HDAC8   POLDIP3   NUF2   UPF3B   NDEL1   NXF2B   PAIP1   MIS12   TRIT1   CENPH   ZWILCH   QTRT2   SPC25   NEK6   INCENP   CENPM   PDS5B   THG1L   DUS2   NDE1   IGF2BP1   RCC2   SAE1   UBA2   NXF1   TRMT112   NXT1   AGO2   NUP50   SMC3   NUDC   CHTOP   RBM8A   MAD1L1   IGF2BP2   LAGE3   NUP160   CCT6B   TPRKB   KIF5B   NUP107   KLC2   KLC4   NUP37  

Gene RIF (1)

PMID Text
26391640 Data present the crystal structure of full length Nup43 and show that it adopts a canonical WD40 fold similar to other members of the family and interacts with Nup85-Seh1L complex to form a ternary complex.

AA Sequence 

MEEIYAKFVSQKISKTRWRPLPPGSLQTAETFATGSWDNEENYISLWSIGDFGNLDSDGGFEGDHQLLCD      1 - 70
IRHHGDVMDLQFFDQERIVAASSTGCVTVFLHHPNNQTLSVNQQWTTAHYHTGPGSPSYSSAPCTGVVCN     71 - 140
NPEIVTVGEDGRINLFRADHKEAVRTIDNADSSTLHAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQI    141 - 210
LSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDVRQGTMPVSLLKAHEAEMWEVHFHPSNPEHLFTC    211 - 280
SEDGSLWHWDASTDVPEKSSLFHQGGRSSTFLSHSISNQANVHQSVISSWLSTDPAKDRIEITSLLPSRS    281 - 350
LSVNTLDVLGPCLVCGTDAEAIYVTRHLFS                                            351 - 380
//

Text Mined References (18)

PMID Year Title
26391640 2015 Crystal structure of human nuclear pore complex component NUP43.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
17363900 2007 The human Nup107-160 nuclear pore subcomplex contributes to proper kinetochore functions.
17360435 2007 Cell-cycle-dependent phosphorylation of the nuclear pore Nup107-160 subcomplex.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146057 2004 The entire Nup107-160 complex, including three new members, is targeted as one entity to kinetochores in mitosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12228227 2002 Docking of HIV-1 Vpr to the nuclear envelope is mediated by the interaction with the nucleoporin hCG1.
12196509 2002 Proteomic analysis of the mammalian nuclear pore complex.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10601273 1999 Nuclear import of hepatic glucokinase depends upon glucokinase regulatory protein, whereas export is due to a nuclear export signal sequence in glucokinase.