Property Summary

NCBI Gene PubMed Count 19
PubMed Score 16.08
PubTator Score 11.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma 1.200 1.4e-14
osteosarcoma 1.508 3.2e-03
acute quadriplegic myopathy 1.189 3.2e-05
sonic hedgehog group medulloblastoma 1.100 1.3e-02

Gene RIF (2)

PMID Text
20200978 Observational study of gene-disease association. (HuGE Navigator)
18256286 defined regions of Nup53 that bind to neighboring nucleoporins as well as those domains that target Nup53 to the nuclear pore complex.

AA Sequence

MAAFAVEPQGPALGSEPMMLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQPRSISGPSVGVMEMRSPLLA      1 - 70
GGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQPNISVMQSPLVGVTSTPGTGQSMFSPA     71 - 140
SIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDSWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNW    141 - 210
MHIRYQSKLQARKALSKDGRIFGESIMIGVKPCIDKSVMESSDRCALSSPSLAFTPPIKTLGTPTQPGST    211 - 280
PRISTMRPLATAYKASTSDYQVISDRQTPKKDESLVSKAMEYMFGW                            281 - 326
//

Text Mined References (30)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22960634 2012 Dimerization and direct membrane interaction of Nup53 contribute to nuclear pore complex assembly.
21444689 2011 System analysis shows distinct mechanisms and common principles of nuclear envelope protein dynamics.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19641022 2009 Transportin regulates major mitotic assembly events: from spindle to nuclear pore assembly.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19379481 2009 A transcriptional sketch of a primary human breast cancer by 454 deep sequencing.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18256286 2008 Nup53 is required for nuclear envelope and nuclear pore complex assembly.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16600873 2006 The conserved transmembrane nucleoporin NDC1 is required for nuclear pore complex assembly in vertebrate cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15703211 2005 Vertebrate Nup53 interacts with the nuclear lamina and is required for the assembly of a Nup93-containing complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12228227 2002 Docking of HIV-1 Vpr to the nuclear envelope is mediated by the interaction with the nucleoporin hCG1.
12196509 2002 Proteomic analysis of the mammalian nuclear pore complex.
10601273 1999 Nuclear import of hepatic glucokinase depends upon glucokinase regulatory protein, whereas export is due to a nuclear export signal sequence in glucokinase.