Property Summary

NCBI Gene PubMed Count 27
PubMed Score 12.81
PubTator Score 3.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma 1.700 4.2e-02
ependymoma 2.500 6.1e-03
oligodendroglioma 2.300 3.7e-03
psoriasis -1.700 1.5e-04
glioblastoma 2.100 1.4e-10
osteosarcoma -2.205 3.6e-08
sonic hedgehog group medulloblastoma 2.400 3.6e-06
atypical teratoid / rhabdoid tumor 2.300 1.2e-07
medulloblastoma, large-cell 2.500 3.7e-05
primitive neuroectodermal tumor 2.700 6.5e-07
intraductal papillary-mucinous neoplasm ... 1.100 2.3e-02
lung cancer 1.500 5.2e-04
pediatric high grade glioma 2.000 1.3e-06
pilocytic astrocytoma 1.700 7.2e-06
aldosterone-producing adenoma -1.030 3.1e-02
ovarian cancer -1.200 6.3e-03

Protein-protein Interaction (209)

POM121C   KIF2A   DDX39A   IGF2BP3   NDC80   XPO1   CASC3   IPO8   NUPL2   POLR2D   ZW10   XPOT   BUB1   RAD21   CDC40   BUB1B   DIAPH2   CLASP2   ZC3H11A   PSIP1   NUP155   CCNB2   ZWINT   SLU7   CDK1   EIF4E   NPM1   EPRS   HNRNPC   HSPA1B   HSPA1B   TOP2A   PABPC1   TPR   CCNB1   HMGA1   POLR2C   POLR2E   SP100   EIF4B   POLR2A   U2AF2   ZFP36   PML   CLIP1   POLR2B   GCK   NUP214   PPP1CC   POLR2I   NUP62   RPS27   PAFAH1B1   RANBP1   RANGAP1   CENPF   NUP153   RANBP2   KNTC1   POLR2H   POLR2J   NUP98   PLK1   POLR2K   SEC13   SUMO3   NUP107   EIF4A1   CDC42   POLR2F   MAGOH   SUMO2   POLR2G   HIST2H4A   RAN   POLR2L   SUMO1   UBE2I   HIST1H3F   RAE1   SRSF3   H3F3B   U2AF1   SRSF2   CENPE   EIF4G1   SRSF11   ZFP36L1   SRSF1   SRSF4   CDC20   SRSF9   SRSF5   SRSF6   MAD2L1   ITGB3BP   HNRNPD   EIF4A2   SMC1A   RNPS1   MAPRE1   SRSF7   PDS5A   ERCC6L   CTU2   PAN2   HIKESHI   CDCA8   SGO2   PAN3   SGO1   NUP188   THOC7   CENPP   PMF1   HIST2H3D   CENPU   CENPQ   TAOK1   NUP54   CLASP1   TRMT11   WAPL   CTU1   ALYREF   THOC6   SRRM1   TRMT44   CENPL   NUP93   CENPS   STAG2   KIF2B   SPC24   NUP43   NUP37   NUP35   KNL1   THOC2   KIF18A   NEK9   NSUN6   NUP210   U2AF1L4   NUP133   SKA2   STAG1   AHCTF1   DHX38   NUP205   KHSRP   MAGOHB   SKA1   CENPT   ALKBH8   SPDL1   SEH1L   CDCA5   THOC1   AURKB   CENPN   POM121   NSL1   THOC3   NUP88   KIF2C   B9D2   CENPK   URM1   NDC1   CENPO   NUP58   NUP85   QTRT1   HDAC8   POLDIP3   NUF2   UPF3B   NDEL1   NXF2B   PAIP1   MIS12   TRIT1   CENPH   ZWILCH   QTRT2   SPC25   NEK6   INCENP   CENPM   PDS5B   THG1L   DUS2   NDE1   IGF2BP1   RCC2   SAE1   UBA2   NXF1   TRMT112   NXT1   AGO2   NUP50   SMC3   NUDC   CHTOP   RBM8A   MAD1L1   IGF2BP2  

Gene RIF (11)

PMID Text
26527604 transcriptome sequencing of patient-derived angiosarcoma cells, identified a novel fusion gene NUP160-SLC43A3 found to be expressed in 9 of 25 human angiosarcoma specimens that were examined.
25904327 Nup107-160 complex and its partner Elys dynamically colocalize with Nup98 and CRM1 into endogenous GLFG bodies present in specific HeLa sublines.
22031293 The SUMO-specific isopeptidase SENP2 associates dynamically with nuclear pore complexes through interactions with karyopherins and the Nup107-160 nucleoporin subcomplex.
20974814 The interactions of Nup160 with Pom121 and are predicted to assist in the formation of the nuclear pore and the anchoring of the Nuclear pore complexes to the pore membrane.
20081840 Data show that Nup107-160 promotes spindle assembly through Ran-GTP-regulated nucleation of microtubules by gamma-TuRC at kinetochores, and reveal a relationship between nucleoporins and the microtubule cytoskeleton.
19864462 A major function of the Nup107 complex in mitosis is to ensure the proper localization of the chromosome passenger complex at the centromere.
19576787 Data show that structure-guided sequence comparison of Nup160 and Saccharomyces cerevisiae Nup120 strongly suggests that both proteins adopt the same unique fold despite a low sequence identity of 10%.
18187620 Knockdown of nucleoporin 160kDa (NUP160) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17363900 These data thus provide the first molecular clues underlying the function of the human Nup107-160 complex at kinetochores.
17360435 phosphorylation does not affect interactions within the Nup107-160 subcomplex, but regulates the association of the subcomplex with the NPC and other proteins
16807356 Nup107-160 complex is dynamic in mitosis and that it promotes spindle assembly in a manner that is distinct from its functions at interphase nuclear pores.

AA Sequence

MLHLSAAPPAPPPEVTATARPCLCSVGRRGDGGKMAAAGALERSFVELSGAERERPRHFREFTVCSIGTA      1 - 70
NAVAGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELMEESLDINLLNNAIRLKFQNCSVLPG     71 - 140
GVYVSETQNRVIILMLTNQTVHRLLLPHPSRMYRSELVVDSQMQSIFTDIGKVDFTDPCNYQLIPAVPGI    141 - 210
SPNSTASTAWLSSDGEALFALPCASGGIFVLKLPPYDIPGMVSVVELKQSSVMQRLLTGWMPTAIRGDQS    211 - 280
PSDRPLSLAVHCVEHDAFIFALCQDHKLRMWSYKEQMCLMVADMLEYVPVKKDLRLTAGTGHKLRLAYSP    281 - 350
TMGLYLGIYMHAPKRGQFCIFQLVSTESNRYSLDHISSLFTSQETLIDFALTSTDIWALWHDAENQTVVK    351 - 420
YINFEHNVAGQWNPVFMQPLPEEEIVIRDDQDPREMYLQSLFTPGQFTNEALCKALQIFCRGTERNLDLS    421 - 490
WSELKKEVTLAVENELQGSVTEYEFSQEEFRNLQQEFWCKFYACCLQYQEALSHPLALHLNPHTNMVCLL    491 - 560
KKGYLSFLIPSSLVDHLYLLPYENLLTEDETTISDDVDIARDVICLIKCLRLIEESVTVDMSVIMEMSCY    561 - 630
NLQSPEKAAEQILEDMITIDVENVMEDICSKLQEIRNPIHAIGLLIREMDYETEVEMEKGFNPAQPLNIR    631 - 700
MNLTQLYGSNTAGYIVCRGVHKIASTRFLICRDLLILQQLLMRLGDAVIWGTGQLFQAQQDLLHRTAPLL    701 - 770
LSYYLIKWGSECLATDVPLDTLESNLQHLSVLELTDSGALMANRFVSSPQTIVELFFQEVARKHIISHLF    771 - 840
SQPKAPLSQTGLNWPEMITAITSYLLQLLWPSNPGCLFLECLMGNCQYVQLQDYIQLLHPWCQVNVGSCR    841 - 910
FMLGRCYLVTGEGQKALECFCQAASEVGKEEFLDRLIRSEDGEIVSTPRLQYYDKVLRLLDVIGLPELVI    911 - 980
QLATSAITEAGDDWKSQATLRTCIFKHHLDLGHNSQAYEALTQIPDSSRQLDCLRQLVVVLCERSQLQDL    981 - 1050
VEFPYVNLHNEVVGIIESRARAVDLMTHNYYELLYAFHIYRHNYRKAGTVMFEYGMRLGREVRTLRGLEK   1051 - 1120
QGNCYLAALNCLRLIRPEYAWIVQPVSGAVYDRPGASPKRNHDGECTAAPTNRQIEILELEDLEKECSLA   1121 - 1190
RIRLTLAQHDPSAVAVAGSSSAEEMVTLLVQAGLFDTAISLCQTFKLPLTPVFEGLAFKCIKLQFGGEAA   1191 - 1260
QAEAWAWLAANQLSSVITTKESSATDEAWRLLSTYLERYKVQNNLYHHCVINKLLSHGVPLPNWLINSYK   1261 - 1330
KVDAAELLRLYLNYDLLEEAVDLVSEYVDAVLGKGHQYFGIEFPLSATAPMVWLPYSSIDQLLQALGENS   1331 - 1400
ANSHNIALSQKILDKLEDYQQKVDKATRDLLYRRTL                                     1401 - 1436
//

Text Mined References (36)

PMID Year Title
26527604 2015 NUP160-SLC43A3 is a novel recurrent fusion oncogene in angiosarcoma.
25904327 2015 Intranuclear dynamics of the Nup107-160 complex.
25416956 2014 A proteome-scale map of the human interactome network.
25173106 2014 Genome-wide analysis of multi-ancestry cohorts identifies new loci influencing intraocular pressure and susceptibility to glaucoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22031293 2011 The SUMO-specific isopeptidase SENP2 associates dynamically with nuclear pore complexes through interactions with karyopherins and the Nup107-160 nucleoporin subcomplex.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20974814 2010 Pom121 links two essential subcomplexes of the nuclear pore complex core to the membrane.
20081840 2010 The Nup107-160 complex and gamma-TuRC regulate microtubule polymerization at kinetochores.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19864462 2009 The Nup107-160 nucleoporin complex promotes mitotic events via control of the localization state of the chromosome passenger complex.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19576787 2009 The structure of the scaffold nucleoporin Nup120 reveals a new and unexpected domain architecture.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17363900 2007 The human Nup107-160 nuclear pore subcomplex contributes to proper kinetochore functions.
17360435 2007 Cell-cycle-dependent phosphorylation of the nuclear pore Nup107-160 subcomplex.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17098863 2006 ELYS is a dual nucleoporin/kinetochore protein required for nuclear pore assembly and proper cell division.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16807356 2006 The Nup107-160 nucleoporin complex is required for correct bipolar spindle assembly.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15146057 2004 The entire Nup107-160 complex, including three new members, is targeted as one entity to kinetochores in mitosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12228227 2002 Docking of HIV-1 Vpr to the nuclear envelope is mediated by the interaction with the nucleoporin hCG1.
11684705 2001 Novel vertebrate nucleoporins Nup133 and Nup160 play a role in mRNA export.
11564755 2001 An evolutionarily conserved NPC subcomplex, which redistributes in part to kinetochores in mammalian cells.
10601273 1999 Nuclear import of hepatic glucokinase depends upon glucokinase regulatory protein, whereas export is due to a nuclear export signal sequence in glucokinase.
8724849 1996 Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1.