Property Summary

NCBI Gene PubMed Count 78
PubMed Score 124.63
PubTator Score 87.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
interstitial lung disease -1.100 3.3e-02
Waldenstrons macroglobulinemia 1.156 4.3e-02
Multiple myeloma 1.896 3.5e-04
psoriasis 1.500 2.1e-04
osteosarcoma 1.155 4.3e-04
Amyotrophic Lateral Sclerosis 1.133 2.2e-06
sonic hedgehog group medulloblastoma 1.100 6.3e-04
ovarian cancer 2.500 9.0e-04
dermatomyositis 1.600 2.1e-04

Gene RIF (62)

PMID Text
26051542 Nucleoporin Nup153 is required for NPC assembly during interphase but not during mitotic exit. It functions in interphasic NPC formation by binding directly to the inner nuclear membrane via an N-terminal amphipathic helix.
26030189 Study assessed the extent of collapse of a Nup153 fragment in molecular dynamics simulations and compared the results to single molecule FRET and small-angle X-ray scattering experiments of this peptide
25731161 Knockdown of nucleoporin 153kDa (NUP153) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
25518861 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
25485891 Our data indicate a central function of Nup153 in the organization of the nucleus, not only at the periphery, but throughout the entire nuclear interior.
25410863 The data presented here suggest that BGLF4 interferes with the normal functions of Nup62 and Nup153 and preferentially helps the nuclear import of viral proteins for viral DNA replication and assembly.
25356722 NUP153 and CPSF6 have overlapping binding sites, but each makes unique capsid monomers (CA) interactions. Multiple ligands share an overlapping interface in HIV-1 capsid that is lost upon viral disassembly.
25356722 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
25147212 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
25036886 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
24739174 These data reveal an emergent Kap-centric barrier mechanism that may underlie mechanistic and kinetic control in the nuclear pore complex.
24525292 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
24418548 A hydrophobic patch 65LRLFV69 within the zinc-binding domain is essential for the nuclear import and localization of HPV8 E7 via hydrophobic interactions with Nup62 and Nup153.
24130490 a subset of lentiviral CA proteins directly engage FG-motifs present on NUP153 to affect viral nuclear import.
24130490 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
24051001 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
23883001 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
23523133 The roles of NUP153 and nup98 in the integration and replication of HIV-1 in human Jurkat lymphocytes are reported.
23523133 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
23523133 Knockdown of nucleoporin 153kDa (NUP153) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
23097450 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
23007389 analysis of the Nup153-Nup50 protein interface and its role in nuclear import
22928108 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
22688647 The Nup153 binds to both SENP1 and SENP2 and does so by interacting with the unique N-terminal domain of Nup153 as well as a specific region within the C-terminal FG-rich region.
22510057 Nup153 binds to importin alpha
22249246 human nucleoporin 153 (NUP153) has a role in repair of DSBs and in the activation of DNA damage checkpoints.
22174692 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
22118420 A significant association of a polymorphic marker (rs2328136) near the NUP153 gene (which produces a 153 kDa nucleoporin) was obtained
22082286 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
22075984 Data show that the C-terminal part of NUP153 is required for effective 53BP1 nuclear import, and that 53BP1 is imported to the nucleus through the NUP153-importin-beta interplay.
21994675 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
21983083 The N-terminal domain of Nup153 and its C terminus associate with the Ig-fold domain of A- and B-type lamins.
21858095 Data suggest NUP153 plays a crucial role in the nuclear localization of the DICER1 protein.
21593146 results suggest that capsid, likely by the qualities of its uncoating, determines whether HIV-1 requires cellular NUP153 for PIC nuclear import
21593146 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
21555518 NUP153 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21489275 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
21327106 Nup153 levels regulate the localization of Mad1 during the metaphase/anaphase transition thereby affecting its phoshorylation status and in turn spindle checkpoint activity and mitotic exit.
21327100 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
21318276 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
20227665 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
19454010 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
19369352 HIV-1 integrase binds directly to nucleoporin NUP153 to mediate active nuclear import.
19369352 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
19158386 FG-rich region of Nup153 was required to rescue defects in late mitosis
18984154 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
18854154 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
18854154 Knockdown of nucleoporin 153kDa (NUP153) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187620 Knockdown of nucleoporin 153kDa (NUP153) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18068677 The formation of high molecular mass complexes containing importin-alpha, Nup153 and Nup88 is increased upon oxidant treatment.
17916694 study found binding interactions with karyopherin-beta1 caused FG domains of nucleoporin Nup153 to collapse into compact molecular conformations; reversible collapse of the FG domains may play an important role in regulating nucleocytoplasmic transport
17615301 Although full-length Nup1p or Nup153 does not complement Nup124p, the functionality of their conserved domains with reference to Tf1 activity suggests that these three proteins evolved from a common ancestor.
17426026 Nup153 zinc fingers bound GDP and GTP forms of Ran with similar affinities, indicating that this interaction is not influenced by a nucleotide-dependent conformational switch
16543150 MSL complex interacts with components of the nuclear pore, in particular Mtor/TPR and Nup153. Knockdown of Mtor or Nup153 results in loss of the typical MSL X-chromosomal staining and dosage compensation in Drosophila male cells but not in female cells.
15659641 in vitro-translated Nup153 coimmunoprecipitate HIV-1 Vpr; Nup153 shares a unique N-terminal domain with Nup124 that is absolutely essential for Tf1 transposition
15659641 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
15632149 nuclear import of the transcription factor PU.1 occurs via RanGTP-stimulated binding to Nup153
14718558 Nup153 and Nup98 have distinct domains to mediate transcription-dependent mobility
12191473 Smad2 nucleocytoplasmic shuttling by nucleoporins CAN/Nup214 and Nup153 feeds TGFbeta signaling complexes in the cytoplasm and nucleus.
12163599 Relocation of cellular proteins and inhibition of nuclear import in Hela cells during rhinovirus type 14 infection correlated with the degradation of Nup153
11238447 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide
10069809 Full-length NUP153 binids to the CA hexamer with lower affinity compared with the CPSF6 peptide

AA Sequence

MASGAGGVGGGGGGKIRTRRCHQGPIKPYQQGRQQHQGILSRVTESVKNIVPGWLQRYFNKNEDVCSCST      1 - 70
DTSEVPRWPENKEDHLVYADEESSNITDGRITPEPAVSNTEEPSTTSTASNYPDVLTRPSLHRSHLNFSM     71 - 140
LESPALHCQPSTSSAFPIGSSGFSLVKEIKDSTSQHDDDNISTTSGFSSRASDKDITVSKNTSLPPLWSP    141 - 210
EAERSHSLSQHTATSSKKPAFNLSAFGTLSPSLGNSSILKTSQLGDSPFYPGKTTYGGAAAAVRQSKLRN    211 - 280
TPYQAPVRRQMKAKQLSAQSYGVTSSTARRILQSLEKMSSPLADAKRIPSIVSSPLNSPLDRSGIDITDF    281 - 350
QAKREKVDSQYPPVQRLMTPKPVSIATNRSVYFKPSLTPSGEFRKTNQRIDNKCSTGYEKNMTPGQNREQ    351 - 420
RESGFSYPNFSLPAANGLSSGVGGGGGKMRRERTRFVASKPLEEEEMEVPVLPKISLPITSSSLPTFNFS    421 - 490
SPEITTSSPSPINSSQALTNKVQMTSPSSTGSPMFKFSSPIVKSTEANVLPPSSIGFTFSVPVAKTAELS    491 - 560
GSSSTLEPIISSSAHHVTTVNSTNCKKTPPEDCEGPFRPAEILKEGSVLDILKSPGFASPKIDSVAAQPT    561 - 630
ATSPVVYTRPAISSFSSSGIGFGESLKAGSSWQCDTCLLQNKVTDNKCIACQAAKLSPRDTAKQTGIETP    631 - 700
NKSGKTTLSASGTGFGDKFKPVIGTWDCDTCLVQNKPEAIKCVACETPKPGTCVKRALTLTVVSESAETM    701 - 770
TASSSSCTVTTGTLGFGDKFKRPIGSWECSVCCVSNNAEDNKCVSCMSEKPGSSVPASSSSTVPVSLPSG    771 - 840
GSLGLEKFKKPEGSWDCELCLVQNKADSTKCLACESAKPGTKSGFKGFDTSSSSSNSAASSSFKFGVSSS    841 - 910
SSGPSQTLTSTGNFKFGDQGGFKIGVSSDSGSINPMSEGFKFSKPIGDFKFGVSSESKPEEVKKDSKNDN    911 - 980
FKFGLSSGLSNPVSLTPFQFGVSNLGQEEKKEELPKSSSAGFSFGTGVINSTPAPANTIVTSENKSSFNL    981 - 1050
GTIETKSASVAPFTCKTSEAKKEEMPATKGGFSFGNVEPASLPSASVFVLGRTEEKQQEPVTSTSLVFGK   1051 - 1120
KADNEEPKCQPVFSFGNSEQTKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQTSTTADQGAAKPVF   1121 - 1190
SFLNNSSSSSSTPATSAGGGIFGSSTSSSNPPVATFVFGQSSNPVSSSAFGNTAESSTSQSLLFSQDSKL   1191 - 1260
ATTSSTGTAVTPFVFGPGASSNNTTTSGFGFGATTTSSSAGSSFVFGTGPSAPSASPAFGANQTPTFGQS   1261 - 1330
QGASQPNPPGFGSISSSTALFPTGSQPAPPTFGTVSSSSQPPVFGQQPSQSAFGSGTTPNSSSAFQFGSS   1331 - 1400
TTNFNFTNNSPSGVFTFGANSSTPAASAQPSGSGGFPFNQSPAAFTVGSNGKNVFSSSGTSFSGRKIKTA   1401 - 1470
VRRRK                                                                    1471 - 1475
//

Text Mined References (98)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26051542 2015 Nup153 Recruits the Nup107-160 Complex to the Inner Nuclear Membrane for Interphasic Nuclear Pore Complex Assembly.
26030189 2015 Kirkwood-Buff Approach Rescues Overcollapse of a Disordered Protein in Canonical Protein Force Fields.
25485891 2014 Structural characterization of altered nucleoporin Nup153 expression in human cells by thin-section electron microscopy.
25410863 2015 BGLF4 kinase modulates the structure and transport preference of the nuclear pore complex to facilitate nuclear import of Epstein-Barr virus lytic proteins.
25356722 2014 Host cofactors and pharmacologic ligands share an essential interface in HIV-1 capsid that is lost upon disassembly.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24739174 2014 Karyopherin-centric control of nuclear pores based on molecular occupancy and kinetic analysis of multivalent binding with FG nucleoporins.
24418548 2014 Nuclear import of cutaneous beta genus HPV8 E7 oncoprotein is mediated by hydrophobic interactions between its zinc-binding domain and FG nucleoporins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24130490 2013 Nucleoporin NUP153 phenylalanine-glycine motifs engage a common binding pocket within the HIV-1 capsid protein to mediate lentiviral infectivity.
23523133 2013 Nup153 and Nup98 bind the HIV-1 core and contribute to the early steps of HIV-1 replication.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23238392 2013 Facilitated aggregation of FG nucleoporins under molecular crowding conditions.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23007389 2012 The Nup153-Nup50 protein interface and its role in nuclear import.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22688647 2012 Two distinct sites in Nup153 mediate interaction with the SUMO proteases SENP1 and SENP2.
22623767 2012 Epstein-Barr virus protein kinase BGLF4 targets the nucleus through interaction with nucleoporins.
22541429 2012 Hikeshi, a nuclear import carrier for Hsp70s, protects cells from heat shock-induced nuclear damage.
22510057 2012 The interaction between importin-? and Nup153 promotes importin-?/?-mediated nuclear import.
22253824 2012 Localization of nucleoporin Tpr to the nuclear pore complex is essential for Tpr mediated regulation of the export of unspliced RNA.
22249246 2012 The nucleoporin 153, a novel factor in double-strand break repair and DNA damage response.
22118420 2012 A genome-wide search for non-UGT1A1 markers associated with unconjugated bilirubin level reveals significant association with a polymorphic marker near a gene of the nucleoporin family.
22075984 2012 Nucleoporin NUP153 guards genome integrity by promoting nuclear import of 53BP1.
21983083 Distinct association of the nuclear pore protein Nup153 with A- and B-type lamins.
21858095 2011 Nuclear pore complex protein mediated nuclear localization of dicer protein in human cells.
21593146 2011 The requirement for nucleoporin NUP153 during human immunodeficiency virus type 1 infection is determined by the viral capsid.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21327106 The nucleoporin Nup153 affects spindle checkpoint activity due to an association with Mad1.
21327100 The nuclear pore complex: a new dynamic in HIV-1 replication.
21269460 2011 Initial characterization of the human central proteome.
20561986 2010 The nucleoporin Nup153 maintains nuclear envelope architecture and is required for cell migration in tumor cells.
20407419 2010 Protein Tpr is required for establishing nuclear pore-associated zones of heterochromatin exclusion.
20133940 2010 Nucleoporin translocated promoter region (Tpr) associates with dynein complex, preventing chromosome lagging formation during mitosis.
20126445 2010 Nucleoporin 153 arrests the nuclear import of hepatitis B virus capsids in the nuclear basket.
20123736 2010 TRAP150 activates pre-mRNA splicing and promotes nuclear mRNA degradation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20068230 2010 Extensive crosstalk between O-GlcNAcylation and phosphorylation regulates cytokinesis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369352 2009 Integrase interacts with nucleoporin NUP153 to mediate the nuclear import of human immunodeficiency virus type 1.
19158386 2009 The nucleoporin Nup153 has separable roles in both early mitotic progression and the resolution of mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18596238 2008 The DEAD-box RNA helicase DDX3 associates with export messenger ribonucleoproteins as well as tip-associated protein and participates in translational control.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18068677 2008 Oxidative stress mislocalizes and retains transport factor importin-alpha and nucleoporins Nup153 and Nup88 in nuclei where they generate high molecular mass complexes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17916694 2007 Nanomechanical basis of selective gating by the nuclear pore complex.
17615301 2007 Multiple conserved domains of the nucleoporin Nup124p and its orthologs Nup1p and Nup153 are critical for nuclear import and activity of the fission yeast Tf1 retrotransposon.
17426026 2007 Molecular characterization of the Ran-binding zinc finger domain of Nup153.
17255949 2007 Mxi2 promotes stimulus-independent ERK nuclear translocation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16543150 2006 Nuclear pore components are involved in the transcriptional regulation of dosage compensation in Drosophila.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16133350 2005 Versatility at the nuclear pore complex: lessons learned from the nucleoporin Nup153.
15659641 2005 The functionally conserved nucleoporins Nup124p from fission yeast and the human Nup153 mediate nuclear import and activity of the Tf1 retrotransposon and HIV-1 Vpr.
15632149 2005 Carrier-independent nuclear import of the transcription factor PU.1 via RanGTP-stimulated binding to Nup153.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15229283 2004 Nucleoporins as components of the nuclear pore complex core structure and Tpr as the architectural element of the nuclear basket.
14718558 2004 Distinct functional domains within nucleoporins Nup153 and Nup98 mediate transcription-dependent mobility.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12917407 2003 Distinct domain utilization by Smad3 and Smad4 for nucleoporin interaction and nuclear import.
12802065 2003 Direct interaction with nup153 mediates binding of Tpr to the periphery of the nuclear pore complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12228227 2002 Docking of HIV-1 Vpr to the nuclear envelope is mediated by the interaction with the nucleoporin hCG1.
12192048 2002 Enzymes of the SUMO modification pathway localize to filaments of the nuclear pore complex.
12191473 2002 Smad2 nucleocytoplasmic shuttling by nucleoporins CAN/Nup214 and Nup153 feeds TGFbeta signaling complexes in the cytoplasm and nucleus.
12163599 2002 Inhibition of nuclear import and alteration of nuclear pore complex composition by rhinovirus.
12138183 2002 Steady-state nuclear localization of exportin-t involves RanGTP binding and two distinct nuclear pore complex interaction domains.
11896061 2002 Association of the human SUMO-1 protease SENP2 with the nuclear pore.
11839768 2002 Tpr is localized within the nuclear basket of the pore complex and has a role in nuclear protein export.
11777942 2002 Exportin-5, a novel karyopherin, mediates nuclear export of double-stranded RNA binding proteins.
11598013 2001 The nucleoporin Nup153 is required for nuclear pore basket formation, nuclear pore complex anchoring and import of a subset of nuclear proteins.
11574060 2001 The nuclear pore complex.
11567018 2001 RNA association defines a functionally conserved domain in the nuclear pore protein Nup153.
11266456 2001 Gradient of increasing affinity of importin beta for nucleoporins along the pathway of nuclear import.
11238447 2001 Cofactor requirements for nuclear export of Rev response element (RRE)- and constitutive transport element (CTE)-containing retroviral RNAs. An unexpected role for actin.
11073998 2000 TAP (NXF1) belongs to a multigene family of putative RNA export factors with a conserved modular architecture.
11024021 2000 Identification of two novel RanGTP-binding proteins belonging to the importin beta superfamily.
10749866 2000 Phosphorylation of the nuclear transport machinery down-regulates nuclear protein import in vitro.
10668806 2000 The C-terminal domain of TAP interacts with the nuclear pore complex and promotes export of specific CTE-bearing RNA substrates.
10629106 1999 Nuclear import and export pathways.
10601273 1999 Nuclear import of hepatic glucokinase depends upon glucokinase regulatory protein, whereas export is due to a nuclear export signal sequence in glucokinase.
10202161 1999 Nup153 is an M9-containing mobile nucleoporin with a novel Ran-binding domain.
10069809 1999 The nucleoporin nup153 plays a critical role in multiple types of nuclear export.
9847314 1999 Nucleoporins nup98 and nup214 participate in nuclear export of human immunodeficiency virus type 1 Rev.
9275187 1997 RanGTP-mediated nuclear export of karyopherin alpha involves its interaction with the nucleoporin Nup153.
9114010 1997 Cloning and characterization of human karyopherin beta3.
8110839 1994 Sequence analysis of a cDNA encoding a human nuclear pore complex protein, hnup153.