Property Summary

NCBI Gene PubMed Count 34
PubMed Score 21.94
PubTator Score 11.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 2.047 1.0e-07
group 4 medulloblastoma 1.200 1.5e-04
medulloblastoma, large-cell 1.800 5.1e-05
lung cancer 1.200 4.4e-03
ovarian cancer 1.400 2.8e-03
dermatomyositis 1.400 1.3e-04

Gene RIF (8)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19674973 Data present crystal structures of yNup170(979-1502) and hNup107(658-925) x hNup133(517-1156), and conservation of domain arrangement and of tertiary structure suggests that Nup157/170 and Nup133 derived from a common ancestor.
18597806 Mermaid (NUP133) shares glycan specificity with DC-SIGN and inhibits the interaction between DC-SIGN and HIV-1 gp120
18570875 The significant topological differences between Nup107 and Nup133 suggest that helical nucleoporin domains of the nuclear pore complex scaffold fall in different classes and fulfill largely nonredundant functions.
18187620 Knockdown of nucleoporin 133kDa (NUP133) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17768364 When complexed with NUP107, this complex will give the first insights into the protein-protein interactions within a core module of the nuclear pore complex.
15557116 human Nup133 contains two domains: a COOH-terminal domain responsible for its interaction with its subcomplex through Nup107; and an NH2-terminal domain whose crystal structure reveals a seven-bladed beta-propeller.

AA Sequence

MFPAAPSPRTPGTGSRRGPLAGLGPGSTPRTASRKGLPLGSAVSSPVLFSPVGRRSSLSSRGTPTRMFPH      1 - 70
HSITESVNYDVKTFGSSLPVKVMEALTLAEVDDQLTINIDEGGWACLVCKEKLIIWKIALSPITKLSVCK     71 - 140
ELQLPPSDFHWSADLVALSYSSPSGEAHSTQAVAVMVATREGSIRYWPSLAGEDTYTEAFVDSGGDKTYS    141 - 210
FLTAVQGGSFILSSSGSQLIRLIPESSGKIHQHILPQGQGMLSGIGRKVSSLFGILSPSSDLTLSSVLWD    211 - 280
RERSSFYSLTSSNISKWELDDSSEKHAYSWDINRALKENITDAIWGSESNYEAIKEGVNIRYLDLKQNCD    281 - 350
GLVILAAAWHSADNPCLIYYSLITIEDNGCQMSDAVTVEVTQYNPPFQSEDLILCQLTVPNFSNQTAYLY    351 - 420
NESAVYVCSTGTGKFSLPQEKIVFNAQGDSVLGAGACGGVPIIFSRNSGLVSITSRENVSILAEDLEGSL    421 - 490
ASSVAGPNSESMIFETTTKNETIAQEDKIKLLKAAFLQYCRKDLGHAQMVVDELFSSHSDLDSDSELDRA    491 - 560
VTQISVDLMDDYPASDPRWAESVPEEAPGFSNTSLIILHQLEDKMKAHSFLMDFIHQVGLFGRLGSFPVR    561 - 630
GTPMATRLLLCEHAEKLSAAIVLKNHHSRLSDLVNTAILIALNKREYEIPSNLTPADVFFREVSQVDTIC    631 - 700
ECLLEHEEQVLRDAPMDSIEWAEVVINVNNILKDMLQAASHYRQNRNSLYRREESLEKEPEYVPWTATSG    701 - 770
PGGIRTVIIRQHEIVLKVAYPQADSNLRNIVTEQLVALIDCFLDGYVSQLKSVDKSSNRERYDNLEMEYL    771 - 840
QKRSDLLSPLLSLGQYLWAASLAEKYCDFDILVQMCEQTDNQSRLQRYMTQFADQNFSDFLFRWYLEKGK    841 - 910
RGKLLSQPISQHGQLANFLQAHEHLSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALA    911 - 980
SDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKK    981 - 1050
ALDLLEYIDEEEDININDLKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLP   1051 - 1120
EVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQI                                     1121 - 1156
//

Text Mined References (48)

PMID Year Title
27194810 2016 Systematic Protein-Protein Interaction Analysis Reveals Intersubcomplex Contacts in the Nuclear Pore Complex.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26411495 2015 Biallelic Mutations in Nuclear Pore Complex Subunit NUP107 Cause Early-Childhood-Onset Steroid-Resistant Nephrotic Syndrome.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
24315095 2013 Integrated structural analysis of the human nuclear pore complex scaffold.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19674973 2009 Architectural nucleoporins Nup157/170 and Nup133 are structurally related and descend from a second ancestral element.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18570875 2008 Structural and functional studies of Nup107/Nup133 interaction and its implications for the architecture of the nuclear pore complex.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17768364 2007 Purification, crystallization and preliminary X-ray analysis of a Nup107-Nup133 heterodimeric nucleoporin complex.
17363900 2007 The human Nup107-160 nuclear pore subcomplex contributes to proper kinetochore functions.
17360435 2007 Cell-cycle-dependent phosphorylation of the nuclear pore Nup107-160 subcomplex.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17314511 2007 Large-scale identification of c-MYC-associated proteins using a combined TAP/MudPIT approach.
17098863 2006 ELYS is a dual nucleoporin/kinetochore protein required for nuclear pore assembly and proper cell division.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
15557116 2004 Structural and functional analysis of Nup133 domains reveals modular building blocks of the nuclear pore complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146057 2004 The entire Nup107-160 complex, including three new members, is targeted as one entity to kinetochores in mitosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12705868 2003 The conserved Nup107-160 complex is critical for nuclear pore complex assembly.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12228227 2002 Docking of HIV-1 Vpr to the nuclear envelope is mediated by the interaction with the nucleoporin hCG1.
11684705 2001 Novel vertebrate nucleoporins Nup133 and Nup160 play a role in mRNA export.
11564755 2001 An evolutionarily conserved NPC subcomplex, which redistributes in part to kinetochores in mammalian cells.
10601273 1999 Nuclear import of hepatic glucokinase depends upon glucokinase regulatory protein, whereas export is due to a nuclear export signal sequence in glucokinase.
10546895 1999 Function and assembly of nuclear pore complex proteins.
10395558 1999 The nuclear pore complex: from molecular architecture to functional dynamics.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.