Property Summary

NCBI Gene PubMed Count 20
PubMed Score 306.09
PubTator Score 19.38

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y6R0 Q7Z4J9
Symbols NBL
CAG3A
CTG3a
NUMBR
NUMB-R
TNRC23
NUMBLIKE

Gene

PANTHER Protein Class (1)

PDB

3F0W  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (9)

PMID Text
26069237 Numb/Numbl control VEGF receptor endocytosis, signaling, and recycling in endothelial cells, which promotes the angiogenic growth of blood vessels.
23681800 Numbl might be involved in the inhibition of growth, proliferation, and invasion of 95-D lung cancer cells.
23440423 Numbl-Klf4 signaling is critical to maintain multiple nodes of metastatic progression, including persistence of cancer-initiating cells.
22593207 data suggest that Numbl regulates glioma cell migration and invasion by abrogating TRAF5-induced activation of NF-KappaB
20079715 NUMBL interacts with TRAF6 and promotes the degradation of TRAF6 in vivo, leading to the inhibition of NF-kappaB signaling pathway.
18940473 Both gene sequence alterations and amplifications of LNX1 and Numbl are present in a subset of human gliomas.
18940473 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of numb homolog (Drosophila)-like (NUMBL) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
16899352 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRSAAASGGPRRPERHLPPAPCGAPGPPETCRTEPDGAGTMNKLRQSLRRRKPAYVPEASRPHQWQADE      1 - 70
DAVRKGTCSFPVRYLGHVEVEESRGMHVCEDAVKKLKAMGRKSVKSVLWVSADGLRVVDDKTKDLLVDQT     71 - 140
IEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDSGERLSHAVGCAFAACLERKQRREKECGVTA    141 - 210
AFDASRTSFAREGSFRLSGGGRPAEREAPDKKKAEAAAAPTVAPGPAQPGHVSPTPATTSPGEKGEAGTP    211 - 280
VAAGTTAAAIPRRHAPLEQLVRQGSFRGFPALSQKNSPFKRQLSLRLNELPSTLQRRTDFQVKGTVPEME    281 - 350
PPGAGDSDSINALCTQISSSFASAGAPAPGPPPATTGTSAWGEPSVPPAAAFQPGHKRTPSEAERWLEEV    351 - 420
SQVAKAQQQQQQQQQQQQQQQQQQQQAASVAPVPTMPPALQPFPAPVGPFDAAPAQVAVFLPPPHMQPPF    421 - 490
VPAYPGLGYPPMPRVPVVGITPSQMVANAFCSAAQLQPQPATLLGKAGAFPPPAIPSAPGSQARPRPNGA    491 - 560
PWPPEPAPAPAPELDPFEAQWAALEGKATVEKPSNPFSGDLQKTFEIEL                         561 - 609
//

Text Mined References (23)

PMID Year Title
26069237 2015 Regulation of vascular endothelial growth factor receptor function in angiogenesis by numb and numb-like.
23681800 2013 Numblike regulates proliferation, apoptosis, and invasion of lung cancer cell.
23440423 2013 Regulation of lung cancer metastasis by Klf4-Numb-like signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22593207 2012 Numbl inhibits glioma cell migration and invasion by suppressing TRAF5-mediated NF-?B activation.
22446962 2012 A genome-wide association study identifies three new risk loci for Kawasaki disease.
20079715 2010 NUMBL interacts with TRAF6 and promotes the degradation of TRAF6.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18940473 2008 Mutation and copy number analysis of LNX1 and Numbl in nervous system tumors.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18299187 2008 NUMBL interacts with TAB2 and inhibits TNFalpha and IL-1beta-induced NF-kappaB activation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16899352 2006 Analysis of coding-polymorphisms in NOTCH-related genes reveals NUMBL poly-glutamine repeat to be associated with schizophrenia in Brazilian and Danish subjects.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12011466 2002 The gamma-secretase-generated intracellular domain of beta-amyloid precursor protein binds Numb and inhibits Notch signaling.
9303539 1997 Binding specificity and in vivo targets of the EH domain, a novel protein-protein interaction module.
9225980 1997 cDNAs with long CAG trinucleotide repeats from human brain.
9169836 1997 Differential expression of mammalian Numb, Numblike and Notch1 suggests distinct roles during mouse cortical neurogenesis.
8755477 1996 Asymmetric localization of a mammalian numb homolog during mouse cortical neurogenesis.
7568168 1995 A protein-binding domain, EH, identified in the receptor tyrosine kinase substrate Eps15 and conserved in evolution.