Property Summary

NCBI Gene PubMed Count 85
PubMed Score 508.28
PubTator Score 440.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
gastric cancer -2.200 4.2e-04
pancreatic cancer -2.200 4.4e-04
interstitial lung disease 1.300 7.1e-03
astrocytic glioma 1.700 7.6e-03
ependymoma 1.800 1.6e-03
oligodendroglioma 2.300 9.4e-04
psoriasis -2.600 2.9e-04
group 4 medulloblastoma 1.800 1.6e-03
medulloblastoma, large-cell 1.300 2.2e-03
acute quadriplegic myopathy 1.108 8.1e-06
tuberculosis -1.900 3.1e-02
pancreatic ductal adenocarcinoma liver m... 1.082 8.2e-03
intraductal papillary-mucinous adenoma (... 2.000 1.5e-03
intraductal papillary-mucinous carcinoma... 1.500 1.3e-02
pancreatic carcinoma -2.200 4.4e-04
ovarian cancer 1.600 7.9e-06
Gaucher disease type 1 -1.300 1.9e-02

Protein-protein Interaction (1)

Gene RIF (49)

PMID Text
26766442 Suppressor APC domain containing 2 negatively regulates the localization of LGN at the cell cortex, likely by competing with NuMA for its binding
25488052 Results show that at low grade of disease, NMP22 test provided a significantly higher sensitivity for the detection of recurrent urothelial carcinoma of the bladder compared to voided urine cytology specimens.
24996901 NuMA interacts with phosphoinositides and links the mitotic spindle with the plasma membrane.During anaphase correct NuMA localization is mediated by direct membrane phospholipid binding.
24976592 Letter: risk factors for false positive results when using urinary NMP22 as biomarker for early detection of bladder cancer.
24725408 Study finds that frictional forces increase nonlinearly with microtubule-associated proteins (MAP) velocity across microtubules and depend on filament polarity, with NuMA's friction being lower when moving toward minus ends, EB1's lower toward plus ends, and PRC1's exhibiting no directional preference.
24350565 Retinoblastoma protein (pRB) have a novel function in regulating the mitotic function of NuMA and spindle organization, which are required for proper cell cycle progression.
24309115 The mitosis-dependent dynamic SUMO-1 modification of NuMA might contribute to NuMA-mediated formation and maintenance of mitotic spindle poles during mitosis.
24165937 Hepatocyte Par1b defines lumen position in concert with the position of the astral microtubule anchoring complex LGN-NuMA to yield the distinct epithelial division phenotypes.
23921553 NuMA phosphorylation by CDK1 couples mitotic progression with cortical dynein function.
23828576 ectopic expression of NuMA can manipulate endogenous p53 and p21 transcriptional expression during interphase.
23707952 ectopic expression of BRAP2 inhibits nuclear localization of HMG20A and NuMA1, and prevents nuclear envelope accumulation of SYNE2.
23589328 NuMA is required for the recruitment of cyclin-dependent kinase 8, a component of the Mediator complex and a promoter of p53-mediated p21 gene function.
23389635 Data indicate that dynein- and astral microtubule-mediated transport of Galphai/LGN/nuclear mitotic apparatus (NuMA) complex from cell cortex to spindle poles.
23368718 Numa regulates spindle assemby in conjunction with Eg5.
23097092 Phosphorylation of NuMA by aurora-A is important for cell survival.
22977735 Studies indicate that the Inscuteable (Insc)and NuMA are mutually exclusive interactors of LGN.
22944692 Positional proteomics analysis identifies the cleavage of human nuclear mitotic apparatus protein 1 (NUMA1) at amino acid residues 2054-2055 by the HIV-1 protease
22719996 NuMA expression was upregulated in tumours, with a significant association with disease stage in mucinous EOC subtypes, lymph node involvement and patient age
22619067 Low NUMA1 is associtated with glioblastoma.
22552228 Without functional NuMA, microtubules lose connection to meiosis I spindle poles, resulting in highly disorganized early spindle assembly.
22023725 During apoptotic rearrangement of interchromatin granule clusters, the nuclear matrix (NuMa rearrangement) and chromatin are closely associated. This process occurs in defined stages and depends on the activity of protein phosphatases, caspases and CAD.
21865670 nuclear matrix protein 22 (nuclear mitotic apparatus protein, NuMA) has a role in upper tract urothelial tumors.
21406448 NuMA is expressed in interphase nuclei of fibroblasts and oocytes.
21297155 Accurate distribution of NuMA is important for oocyte maturation, zygote and embryo development in humans. Proper assembly of NuMA is likely necessary for bipolar spindle organization and human oocyte developmental competence.
21255834 Phenotype onset is correlated with NuMA-RARalpha copy number; mice with higher copy number developing disease later than those with lower copy number.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20479129 Ric-8A and Gi alpha recruit LGN, NuMA, and dynein to the cell cortex to help orient the mitotic spindle.
20467816 These results suggest that NuMA may provide structural support in the interphase nucleus by contributing to the organization of chromatin.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19759176 Data suggest that pADPr provides a dynamic cross-linking function at spindle poles by extending from covalent modification sites on PARP-5a and NuMA and binding noncovalently to NuMA and that this function helps promote assembly of exactly two poles.
19615282 The levels of urinary NMP22 and CK18 in the patients with transitional cell carcinoma of the bladder were significantly higher than those in the non-transitional cell carcinoma of the bladder.
19522705 Inhibiting Crm1 in early metaphase causes the formation of excess acentriolar spindle poles containing NuMA and B23, but does not affect centrosome numbers.
19454010 Positional proteomics analysis identifies the cleavage of human nuclear mitotic apparatus protein 1 (NUMA1) at amino acid residues 2054-2055 by the HIV-1 protease
19124506 Observational study of gene-disease association. (HuGE Navigator)
18417561 Kaposi's sarcoma-associated herpesvirus-encoded LANA can interact with the nuclear mitotic apparatus protein to regulate genome maintenance and segregation.
18331640 The entire coding region and exon-intron boundaries of NuMa were screened in 92 familial breast cancer patients & the results do not support the role of NuMA variants as breast cancer susceptibility alleles.
18331640 Observational study of gene-disease association. (HuGE Navigator)
17609108 critical spindle pole-associated mechanism, called the END (Emi1/NuMA/dynein-dynactin) network, that spatially restricts APC/C activity in early mitosis
17401638 NuMA is a structural element in maintaining nuclear integrity.
17293864 Observational study of gene-disease association. (HuGE Navigator)
17172455 point to the Rae1-NuMA interaction as a critical element for normal spindle formation in mitosis
17108325 NuMA has a role in mammary epithelial differentiation by influencing the organization of chromatin.
16146802 NuMA plays diverse important roles in vertebrate cells [review]
15684076 concluded that variations in the NuMA gene are likely responsible for the observed increased breast cancer risk
15561764 Multiple mechanisms regulate NUMA1 dynamics at spindle poles.
15388855 Proteins and open reading frames with a NuMA C terminus distal portion like region were found in a diverse set of vertebrate species including mammals, birds, amphibia, and early teleost fish.
14737102 role in development of myelodi leukemia with promyelocytic features
12508117 NuMA is cleaved differently in Jurkat T and HeLa cells, suggesting that different sets of caspases are activated in these cell lines. The normal diffuse intranuclear distribution of NuMA changed during apoptosis.
11956313 A domain within the C-terminal tail of NuMA interacts with tubulin and induces bundling and stabilisation of microtubules and leads to formation of abnormal mitotic spindles.

AA Sequence

MTLHATRGAALLSWVNSLHVADPVEAVLQLQDCSIFIKIIDRIHGTEEGQQILKQPVSERLDFVCSFLQK      1 - 70
NRKHPSSPECLVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRDWEQFEYKIQAELAVILKFVLDHEDG     71 - 140
LNLNEDLENFLQKAPVPSTCSSTFPEELSPPSHQAKREIRFLELQKVASSSSGNNFLSGSPASPMGDILQ    141 - 210
TPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELEE    211 - 280
LRDKNESLTMRLHETLKQCQDLKTEKSQMDRKINQLSEENGDLSFKLREFASHLQQLQDALNELTEEHSK    281 - 350
ATQEWLEKQAQLEKELSAALQDKKCLEEKNEILQGKLSQLEEHLSQLQDNPPQEKGEVLGDVLQLETLKQ    351 - 420
EAATLAANNTQLQARVEMLETERGQQEAKLLAERGHFEEEKQQLSSLITDLQSSISNLSQAKEELEQASQ    421 - 490
AHGARLTAQVASLTSELTTLNATIQQQDQELAGLKQQAKEKQAQLAQTLQQQEQASQGLRHQVEQLSSSL    491 - 560
KQKEQQLKEVAEKQEATRQDHAQQLATAAEEREASLRERDAALKQLEALEKEKAAKLEILQQQLQVANEA    561 - 630
RDSAQTSVTQAQREKAELSRKVEELQACVETARQEQHEAQAQVAELELQLRSEQQKATEKERVAQEKDQL    631 - 700
QEQLQALKESLKVTKGSLEEEKRRAADALEEQQRCISELKAETRSLVEQHKRERKELEEERAGRKGLEAR    701 - 770
LQQLGEAHQAETEVLRRELAEAMAAQHTAESECEQLVKEVAAWRERYEDSQQEEAQYGAMFQEQLMTLKE    771 - 840
ECEKARQELQEAKEKVAGIESHSELQISRQQNELAELHANLARALQQVQEKEVRAQKLADDLSTLQEKMA    841 - 910
ATSKEVARLETLVRKAGEQQETASRELVKEPARAGDRQPEWLEEQQGRQFCSTQAALQAMEREAEQMGNE    911 - 980
LERLRAALMESQGQQQEERGQQEREVARLTQERGRAQADLALEKAARAELEMRLQNALNEQRVEFATLQE    981 - 1050
ALAHALTEKEGKDQELAKLRGLEAAQIKELEELRQTVKQLKEQLAKKEKEHASGSGAQSEAAGRTEPTGP   1051 - 1120
KLEALRAEVSKLEQQCQKQQEQADSLERSLEAERASRAERDSALETLQGQLEEKAQELGHSQSALASAQR   1121 - 1190
ELAAFRTKVQDHSKAEDEWKAQVARGRQEAERKNSLISSLEEEVSILNRQVLEKEGESKELKRLVMAESE   1191 - 1260
KSQKLEERLRLLQAETASNSARAAERSSALREEVQSLREEAEKQRVASENLRQELTSQAERAEELGQELK   1261 - 1330
AWQEKFFQKEQALSTLQLEHTSTQALVSELLPAKHLCQQLQAEQAAAEKRHREELEQSKQAAGGLRAELL   1331 - 1400
RAQRELGELIPLRQKVAEQERTAQQLRAEKASYAEQLSMLKKAHGLLAEENRGLGERANLGRQFLEVELD   1401 - 1470
QAREKYVQELAAVRADAETRLAEVQREAQSTARELEVMTAKYEGAKVKVLEERQRFQEERQKLTAQVEQL   1471 - 1540
EVFQREQTKQVEELSKKLADSDQASKVQQQKLKAVQAQGGESQQEAQRLQAQLNELQAQLSQKEQAAEHY   1541 - 1610
KLQMEKAKTHYDAKKQQNQELQEQLRSLEQLQKENKELRAEAERLGHELQQAGLKTKEAEQTCRHLTAQV   1611 - 1680
RSLEAQVAHADQQLRDLGKFQVATDALKSREPQAKPQLDLSIDSLDLSCEEGTPLSITSKLPRTQPDGTS   1681 - 1750
VPGEPASPISQRLPPKVESLESLYFTPIPARSQAPLESSLDSLGDVFLDSGRKTRSARRRTTQIINITMT   1751 - 1820
KKLDVEEPDSANSSFYSTRSAPASQASLRATSSTQSLARLGSPDYGNSALLSLPGYRPTTRSSARRSQAG   1821 - 1890
VSSGAPPGRNSFYMGTCQDEPEQLDDWNRIAELQQRNRVCPPHLKTCYPLESRPSLSLGTITDEEMKTGD   1891 - 1960
PQETLRRASMQPIQIAEGTGITTRQQRKRVSLEPHQGPGTPESKKATSCFPRPMTPRDRHEGRKQSTTEA   1961 - 2030
QKKAAPASTKQADRRQSMAFSILNTPKKLGNSLLRRGASKKALSKASPNTRSGTRRSPRIATTTASAATA   2031 - 2100
AAIGATPRAKGKAKH                                                          2101 - 2115
//

Text Mined References (108)

PMID Year Title
26766442 2016 SAPCD2 Controls Spindle Orientation and Asymmetric Divisions by Negatively Regulating the G?i-LGN-NuMA Ternary Complex.
26562023 2015 Polyglutamylated Tubulin Binding Protein C1orf96/CSAP Is Involved in Microtubule Stabilization in Mitotic Spindles.
26195665 2015 The deubiquitinating enzyme complex BRISC is required for proper mitotic spindle assembly in mammalian cells.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25488052 2015 The use of urinary nuclear matrix protein 22 (NMP22) as a diagnostic adjunct to urine cytology for monitoring of recurrent bladder cancer--institutional experience and review.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24996901 2014 NuMA interacts with phosphoinositides and links the mitotic spindle with the plasma membrane.
24976592 2014 Factors influencing false-positive results for nuclear matrix protein 22.
24725408 2014 Asymmetric friction of nonmotor MAPs can lead to their directional motion in active microtubule networks.
24350565 2014 Interaction between RB protein and NuMA is required for proper alignment of spindle microtubules.
24309115 2014 Cell cycle-dependent SUMO-1 conjugation to nuclear mitotic apparatus protein (NuMA).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24165937 2013 Par1b links lumen polarity with LGN-NuMA positioning for distinct epithelial cell division phenotypes.
23921553 2013 NuMA phosphorylation by CDK1 couples mitotic progression with cortical dynein function.
23828576 2013 Nuclear mitotic apparatus protein, NuMA, modulates p53-mediated transcription in cancer cells.
23783028 2013 RanGTP and CLASP1 cooperate to position the mitotic spindle.
23707952 2013 The BRCA1-binding protein BRAP2 can act as a cytoplasmic retention factor for nuclear and nuclear envelope-localizing testicular proteins.
23589328 2013 NuMA is required for the selective induction of p53 target genes.
23389635 2013 Evidence for dynein and astral microtubule-mediated cortical release and transport of G?i/LGN/NuMA complex in mitotic cells.
23368718 2013 Interaction of NuMA protein with the kinesin Eg5: its possible role in bipolar spindle assembly and chromosome alignment.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23097092 2013 Phosphorylation of NuMA by Aurora-A kinase in PC-3 prostate cancer cells affects proliferation, survival, and interphase NuMA localization.
22977735 2012 On the inscrutable role of Inscuteable: structural basis and functional implications for the competitive binding of NuMA and Inscuteable to LGN.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22719996 2012 NuMA overexpression in epithelial ovarian cancer.
22619067 2012 GAS41 amplification results in overexpression of a new spindle pole protein.
22552228 2012 Error-prone mammalian female meiosis from silencing the spindle assembly checkpoint without normal interkinetochore tension.
22023725 2012 Early apoptotic reorganization of spliceosomal proteins involves caspases, CAD and rearrangement of NuMA.
21865670 2011 Diagnostic value of the nuclear matrix protein 22 test and urine cytology in upper tract urothelial tumors.
21816348 2011 LGN/mInsc and LGN/NuMA complex structures suggest distinct functions in asymmetric cell division for the Par3/mInsc/LGN and G?i/LGN/NuMA pathways.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21406448 2011 Dynamic distribution of NuMA and microtubules in human fetal fibroblasts, developing oocytes and somatic cell nuclear transferred embryos.
21297155 2011 The nuclear mitotic apparatus (NuMA) protein: localization and dynamics in human oocytes, fertilization and early embryos.
21269460 2011 Initial characterization of the human central proteome.
21255834 2011 Correlation among nuclear localization of NuMA-RAR?, deregulation of gene expression and leukemic phenotype of hCG-NuMA-RAR? transgenic mice.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20479129 2010 Ric-8A and Gi alpha recruit LGN, NuMA, and dynein to the cell cortex to help orient the mitotic spindle.
20467816 2010 Silencing of Nuclear Mitotic Apparatus protein (NuMA) accelerates the apoptotic disintegration of the nucleus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20137953 2010 NuMA after 30 years: the matrix revisited.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20068230 2010 Extensive crosstalk between O-GlcNAcylation and phosphorylation regulates cytokinesis.
19759176 2009 Interaction between Poly(ADP-ribose) and NuMA contributes to mitotic spindle pole assembly.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19615282 2009 [Expression and clinical significance of nuclear matrix protein 22 and cytokeratin 18 in transitional cell carcinoma of the bladder].
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19522705 2009 Inhibiting Crm1 causes the formation of excess acentriolar spindle poles containing NuMA and B23, but does not affect centrosome numbers.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19255246 2009 Requirements for NuMA in maintenance and establishment of mammalian spindle poles.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18417561 2008 Kaposi's sarcoma-associated herpesvirus-encoded LANA can interact with the nuclear mitotic apparatus protein to regulate genome maintenance and segregation.
18331714 2008 sSgo1, a major splice variant of Sgo1, functions in centriole cohesion where it is regulated by Plk1.
18331640 2008 Comprehensive analysis of NuMA variation in breast cancer.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17609108 2007 The END network couples spindle pole assembly to inhibition of the anaphase-promoting complex/cyclosome in early mitosis.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17401638 2007 Apoptotic cleavage of NuMA at the C-terminal end is related to nuclear disruption and death amplification.
17293864 2007 A common coding variant in CASP8 is associated with breast cancer risk.
17172455 2006 Rae1 interaction with NuMA is required for bipolar spindle formation.
17108325 2007 NuMA influences higher order chromatin organization in human mammary epithelium.
17092945 2006 A genome scale location analysis of human Staf/ZNF143-binding sites suggests a widespread role for human Staf/ZNF143 in mammalian promoters.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16146802 2006 Role of NuMA in vertebrate cells: review of an intriguing multifunctional protein.
16076287 2005 NuMA is a major acceptor of poly(ADP-ribosyl)ation by tankyrase 1 in mitosis.
15684076 2005 Association of the NuMA region on chromosome 11q13 with breast cancer susceptibility.
15637283 2005 Spindle multipolarity is prevented by centrosomal clustering.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15561764 2004 Multiple mechanisms regulate NuMA dynamics at spindle poles.
15537540 2004 Mammalian Pins is a conformational switch that links NuMA to heterotrimeric G proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15388855 2004 The C terminus of the nuclear protein NuMA: phylogenetic distribution and structure.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14737102 2004 Myeloid leukemia with promyelocytic features in transgenic mice expressing hCG-NuMA-RARalpha.
14718566 2004 TOGp, the human homolog of XMAP215/Dis1, is required for centrosome integrity, spindle pole organization, and bipolar spindle assembly.
12508117 2003 NuMA and nuclear lamins behave differently in Fas-mediated apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11956313 2002 Direct binding of NuMA to tubulin is mediated by a novel sequence motif in the tail domain that bundles and stabilizes microtubules.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11229403 2001 Role of importin-beta in coupling Ran to downstream targets in microtubule assembly.
10739661 2000 Preferential expression of NuMA in the nuclei of proliferating cells.
10075938 1999 Self assembly of NuMA: multiarm oligomers as structural units of a nuclear lattice.
10023777 1999 Interleukin-18 binding protein: a novel modulator of the Th1 cytokine response.
9730450 1998 Sensitivity and specificity of NMP-22, telomerase, and BTA in the detection of human bladder cancer.
9586635 1998 Granzyme B directly and efficiently cleaves several downstream caspase substrates: implications for CTL-induced apoptosis.
9288109 1997 Fusion of retinoic acid receptor alpha to NuMA, the nuclear mitotic apparatus protein, by a variant translocation in acute promyelocytic leukaemia.
8898198 1996 A complex of NuMA and cytoplasmic dynein is essential for mitotic spindle assembly.
8838651 1996 Dynamic changes of NuMA during the cell cycle and possible appearance of a truncated form of NuMA during apoptosis.
8505359 1993 Nuclear proteins of the bovine esophageal epithelium. II. The NuMA gene gives rise to multiple mRNAs and gene products reactive with monoclonal antibody W1.
8408288 1993 Primary structure and microtubule-interacting domain of the SP-H antigen: a mitotic MAP located at the spindle pole and characterized as a homologous protein to NuMA.
8406455 1993 Assignment of the nuclear mitotic apparatus protein NuMA gene to human chromosome 11q13.
7962183 1994 Nuclear mitotic apparatus protein (NuMA): spindle association, nuclear targeting and differential subcellular localization of various NuMA isoforms.
7769006 1995 Mutation of the predicted p34cdc2 phosphorylation sites in NuMA impair the assembly of the mitotic spindle and block mitosis.
7004645 1980 Human-specific nuclear protein that associates with the polar region of the mitotic apparatus: distribution in a human/hamster hybrid cell.
1541636 1992 Primary structure of NuMA, an intranuclear protein that defines a novel pathway for segregation of proteins at mitosis.
1541630 1992 NuMA: an unusually long coiled-coil related protein in the mammalian nucleus.