Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.00
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 1.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Mental Depression 333 0.0 1.2
Disease Target Count Z-score Confidence
Umbilical hernia 93 4.627 2.3
Omphalocele 24 4.342 2.2
Inguinal hernia 14 3.967 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 2.300 1.9e-03

Gene RIF (2)

AA Sequence

MAETKDVFGQEPHPVEDDLYKERTRKRRKSDRDQRFRAFPSMEQSALKEYEKLESRTRRVLSNTYQKLIQ      1 - 70
SVFLDDSIPNGVKYLINRLLALIEKPTVDPIYIALFGSTGAGKSSLINAIIQQAMFLPVSGESICTSCIV     71 - 140
QVSSGCCVQYEAKIHLLSDQEWREELKNLTKLLHRTEELSREEADAWNRDEAVEEATWKLQMIYGNGAES    141 - 210
KNYEELLRAKPKRKIPTSRVITLKAEEAEELSIKLDPYIRTQRRDWDGEAAEMRIWPLIKHVEVTLPKSD    211 - 280
LIPEGVVLVDIPGTGDFNSKRDEMWKKTIDKCSVIWVISDIERVSGGQAHEDLLNESIKACQRGFCRDVA    281 - 350
LVVTKMDKLHLPEYLRERKAGNQAIQSQREAVLERNEMIKLQRTRILKEKLKRKLPADFKVLEASDLVYT    351 - 420
VSAQEYWQQALLTEEETEIPKLREYIRKSLLDKKKRTVTKYVTEAFGLLLLTDSFNSTQNLPNEHLHMSV    421 - 490
LRRFAEEKVELLEKAIAQCFACMEQPLQEGVRTARTSYRCILRACLVRSKGNQGFHQTLKAVCLKNGIYA    491 - 560
SRTLARIDLNEALTQPVYDQIDPVFGSIFRTGKPTGSALMPHIDAFKQSLQEKMTEIGIRSGWKYDSCKK    561 - 630
NFLIQEISAILGGLEDHILRRKRRIYESLTASVQSDLKLCYEEAAQITGKKACERMKDAIRRGVDRQVAE    631 - 700
GMFERAQERMQHQFQQLKTGIVEKVKGSITTMLALASSQGDGLYKELADVGSEYKEMEKLHRSLREVAEN    701 - 770
ARLRKGMQEFLLRASPSKAGPPGTSL                                                771 - 796
//

Text Mined References (11)

PMID Year Title