Property Summary

NCBI Gene PubMed Count 40
PubMed Score 48.76
PubTator Score 30.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
astrocytoma 1.100 1.7e-05
glioblastoma 3.800 6.7e-11
oligodendroglioma 1.300 5.1e-05
posterior fossa group A ependymoma 2.500 8.5e-06
group 3 medulloblastoma 5.100 2.1e-10
atypical teratoid/rhabdoid tumor 3.400 9.4e-12
medulloblastoma, large-cell 4.100 9.9e-09
primitive neuroectodermal tumor 4.400 3.0e-07
Atopic dermatitis 2.000 1.6e-05
adrenocortical carcinoma 2.441 1.0e-03
non-small cell lung cancer 2.824 3.6e-28
intraductal papillary-mucinous adenoma (... 1.600 2.2e-02
intraductal papillary-mucinous carcinoma... 2.800 4.0e-05
intraductal papillary-mucinous neoplasm ... 3.300 1.4e-04
active Crohn's disease 1.095 1.1e-02
pancreatic cancer 1.700 1.9e-05
breast carcinoma 1.700 2.7e-05
Breast cancer 3.600 7.2e-24
lung adenocarcinoma 2.300 1.3e-08
pediatric high grade glioma 3.600 1.0e-07
pilocytic astrocytoma 1.200 1.3e-04
nasopharyngeal carcinoma 2.000 1.0e-04
psoriasis 1.600 2.1e-64
Endometriosis 2.016 1.3e-02
ductal carcinoma in situ 2.000 1.1e-02
invasive ductal carcinoma 2.900 5.2e-05
ulcerative colitis 1.300 7.8e-04
ovarian cancer 3.100 1.6e-06

Gene RIF (19)

PMID Text
26045769 found LncRNA AF339813 was positively regulated by NUF2
25701787 hnRNP K binds to the promoter region of NUF2 and activates its transcription.
25481014 NUF2 was overexpressed in glioma tissues and differentially expressed in a series of glioma cell lines. Depletion of NUF2 by short-hairpin RNA inhibited cell growth in vitro and in vivo.
25374179 NUF2 plays a critical role in the regulation of HCC cell proliferation and apoptosis.
25370920 NUF2 silencing by RANi (RNA interference) reduced the proliferation and colony formation ability of pancreatic cancer cells in vitro.
24247253 These results suggest that CDCA1 could be a prognostic biomarker and a potential therapeutic target for colorectal cancers .
24129578 these findings demonstrated that three buried glutamic acid-lysine pairs, in concert with hydrophobic interactions of core residues, provide the major specificity and stability requirements for Hec1-Nuf2 dimerization
23056589 NDC80, NUF2 and PTN were significantly aberrantly overexpressed in serous adenocarcinomas.
21270439 These data suggest that the CH and tail domains of Hec1 generate essential contacts between kinetochores and microtubules in cells, whereas the Nuf2 CH domain does not.
20508983 Observational study of gene-disease association. (HuGE Navigator)
19878654 cell growths of colorectal and gastric cancers after the siRNA-mediated knockdown of either CDCA1 or KNTC2 were significantly suppressed.
19536175 Observational study of gene-disease association. (HuGE Navigator)
19525938 Chromosome congression in HSET + hNuf2 co-depleted cells required the plus-end directed motor CENP-E , which has been implicated in the gliding of mono-oriented kinetochores alongside adjacent K-fibres.
19081476 alternative splicing variants, M-RIP, HYAL2, CDCA1, and MSMB genes showed differential expressions between cancer cells and corresponding normal tissues.
18770861 CDCA1 may therefore be an ideal tumor-associated antigen useful for the diagnosis and immunotherapy of these cancer
17535814 HsNUF2 and CENP-E are required for organization of stable microtubule-kinetochore attachment that is essential for faithful chromosome segregation in mitosis
15961401 the Spc24, Spc25, Nuf2, and Ndc80/Hec1 complex is a faithful copy of the endogenous Ndc80 complex
15548592 NUF2 is a core component of the kinetochore outer plate essential for organizing microtubule attachment sites.
12438418 Data highlight a specific role for hNuf2 in kinetochore-microtubule attachment and suggest that hNuf2 is part of a molecular linker between the kinetochore attachment site and tubulin subunits within the lattice of attached plus ends.

AA Sequence

METLSFPRYNVAEIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVN      1 - 70
SEVMYPHLMEGFLPFSNLVTHLDSFLPICRVNDFETADILCPKAKRTSRFLSGIINFIHFREACRETYME     71 - 140
FLWQYKSSADKMQQLNAAHQEALMKLERLDSVPVEEQEEFKQLSDGIQELQQSLNQDFHQKTIVLQEGNS    141 - 210
QKKSNISEKTKRLNELKLSVVSLKEIQESLKTKIVDSPEKLKNYKEKMKDTVQKLKNARQEVVEKYEIYG    211 - 280
DSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESDESELKKLKTEENSFKRLMIVKKE    281 - 350
KLATAQFKINKKHEDVKQYKRTVIEDCNKVQEKRGAVYERVTTINQEIQKIKLGIQQLKDAAEREKLKSQ    351 - 420
EIFLNLKTALEKYHDGIEKAAEDSYAKIDEKTAELKRKMFKMST                              421 - 464
//

Text Mined References (45)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26045769 2015 Downregulation of NUF2 inhibits tumor growth and induces apoptosis by regulating lncRNA AF339813.
25701787 2015 Heterogeneous nuclear ribonucleoprotein K upregulates the kinetochore complex component NUF2 and promotes the tumorigenicity of colon cancer cells.
25481014 2014 SiRNA-mediated knockdown against NUF2 suppresses tumor growth and induces cell apoptosis in human glioma cells.
25416956 2014 A proteome-scale map of the human interactome network.
25374179 2014 Silencing of NUF2 inhibits tumor growth and induces apoptosis in human hepatocellular carcinomas.
25370920 2015 siRNA-mediated knockdown against NUF2 suppresses pancreatic cancer proliferation in vitro and in vivo.
24621683 2014 Risk loci for chronic obstructive pulmonary disease: a genome-wide association study and meta-analysis.
24247253 2014 Cell division cycle-associated protein 1 overexpression is essential for the malignant potential of colorectal cancers.
24129578 2013 Complementary interhelical interactions between three buried Glu-Lys pairs within three heptad repeats are essential for Hec1-Nuf2 heterodimerization and mitotic progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085020 2012 The kinetochore-bound Ska1 complex tracks depolymerizing microtubules and binds to curved protofilaments.
23056589 2012 An RNA interference lethality screen of the human druggable genome to identify molecular vulnerabilities in epithelial ovarian cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21270439 2011 The NDC80 complex proteins Nuf2 and Hec1 make distinct contributions to kinetochore-microtubule attachment in mitosis.
21269460 2011 Initial characterization of the human central proteome.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
19946888 2010 Defining the membrane proteome of NK cells.
19878654 2009 siRNA-mediated knockdown against CDCA1 and KNTC2, both frequently overexpressed in colorectal and gastric cancers, suppresses cell proliferation and induces apoptosis.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19525938 2009 Chromosome congression in the absence of kinetochore fibres.
19081476 2009 Cancer-associated splicing variants of the CDCA1 and MSMB genes expressed in cancer cell lines and surgically resected gastric cancer tissues.
18770861 2008 HLA-A2-restricted CTL epitopes of a novel lung cancer-associated cancer testis antigen, cell division cycle associated 1, can induce tumor-reactive CTL.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17535814 2007 Human NUF2 interacts with centromere-associated protein E and is essential for a stable spindle microtubule-kinetochore attachment.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17129783 2006 The conserved KMN network constitutes the core microtubule-binding site of the kinetochore.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
15961401 2005 Architecture of the human ndc80-hec1 complex, a critical constituent of the outer kinetochore.
15548592 2005 Hec1 and nuf2 are core components of the kinetochore outer plate essential for organizing microtubule attachment sites.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15239953 2004 Timing and checkpoints in the regulation of mitotic progression.
15235793 2004 Kinetochore localization and microtubule interaction of the human spindle checkpoint kinase Mps1.
15062103 2004 The RanGAP1-RanBP2 complex is essential for microtubule-kinetochore interactions in vivo.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699129 2004 Identification of two novel components of the human NDC80 kinetochore complex.
14654001 2003 Nuf2 and Hec1 are required for retention of the checkpoint proteins Mad1 and Mad2 to kinetochores.
14602875 2004 Identification of the substrates and interaction proteins of aurora kinases from a protein-protein interaction model.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438418 2002 hNuf2 inhibition blocks stable kinetochore-microtubule attachment and induces mitotic cell death in HeLa cells.
11685532 2001 A conserved protein, Nuf2, is implicated in connecting the centromere to the spindle during chromosome segregation: a link between the kinetochore function and the spindle checkpoint.
11266451 2001 The Ndc80p complex from Saccharomyces cerevisiae contains conserved centromere components and has a function in chromosome segregation.