Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MLPDCLSAEGELRCRRLLAGATARLRARPASAAVLVPLCSVRGVPALLYTLRSSRLTGRHKGDVSFPGGK      1 - 70
CDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQKATVVPVLAGVGPLDPQSLRPNSEEVDEVF     71 - 140
ALPLAHLLQTQNQGYTHFCRGGHFRYTLPVFLHGPHRVWGLTAVITEFALQLLAPGTYQPRLAGLTCSGA    141 - 210
EGLARPKQPLASPCQASSTPGLNKGL                                                211 - 236
//

Text Mined References (7)

PMID Year Title