Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.46
PubTator Score 0.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.927 4.3e-03
non diabetic and post-ischemic heart fai... 1.400 1.4e-02
glioblastoma -1.300 4.2e-03
medulloblastoma, large-cell -1.900 9.8e-03
pancreatic ductal adenocarcinoma liver m... -1.792 4.4e-03
Breast cancer -1.400 2.2e-07
ductal carcinoma in situ -1.500 3.9e-04
invasive ductal carcinoma -2.000 2.1e-03
ulcerative colitis -1.100 8.9e-04
ovarian cancer -1.800 1.2e-11

Gene RIF (1)

PMID Text
19844255 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGE      1 - 70
VCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTLITPFVGLIDHNFQAQPNPAE     71 - 140
VKDVFLVPLAYFLHPQVHDQHYVTRLGHRFINHIFEYTNPEDGVTYQIKGMTANLAVLVAFIILEKKPTF    141 - 210
EVQFNLNDVLASSEELFLKVHKKATSRL                                              211 - 238
//

Text Mined References (7)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11415433 2001 The mouse Nudt7 gene encodes a peroxisomal nudix hydrolase specific for coenzyme A and its derivatives.