Property Summary

NCBI Gene PubMed Count 27
PubMed Score 32.78
PubTator Score 25.70

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (5)

Gene RIF (9)

AA Sequence

MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQR      1 - 70
TLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCT     71 - 140
IHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAK    141 - 210
PFEVPFLKF                                                                 211 - 219
//

Text Mined References (36)

PMID Year Title