Property Summary

NCBI Gene PubMed Count 36
PubMed Score 28.80
PubTator Score 9.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 1.100 6.4e-06
psoriasis -2.300 6.6e-05
ependymoma 1.100 2.4e-07
glioblastoma 1.600 2.3e-06
group 4 medulloblastoma 2.000 6.8e-05
atypical teratoid / rhabdoid tumor 1.600 5.3e-06
medulloblastoma, large-cell 2.300 6.2e-05
primitive neuroectodermal tumor 1.400 3.7e-06
acute quadriplegic myopathy 1.356 9.7e-05
juvenile dermatomyositis 1.060 4.0e-07
non-small cell lung cancer 1.192 6.4e-20
intraductal papillary-mucinous neoplasm ... 1.200 1.1e-02
Breast cancer 2.300 4.8e-02
pediatric high grade glioma 1.400 8.5e-06
Alzheimer's disease -1.400 3.3e-02
Pick disease -1.500 8.7e-05
ovarian cancer 1.500 1.8e-04
Gaucher disease type 1 -1.100 4.9e-03

Gene RIF (11)

PMID Text
26312503 The authors identify NUDT21 as a novel candidate for intellectual disability and neuropsychiatric disease, and elucidate a mechanism of pathogenesis by MeCP2 dysregulation via altered alternative polyadenylation.
23125841 Tandem affinity purification and mass spectrometry analysis identify cleavage and polyadenylation specificity factor 5 (CPSF5; NUDT21), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21295486 Structure of a CFI(m)25/CFI(m)68 RRM heterotetramer and biochemical data indicated that CFIm25 specifically recognized two UGUA elements, CFIm68 facilitates looping of the intervening RNA. CFIm-mediated RNA looping may regulate alternative polyadnylation.
21295486 Crystal structure of CFIm25-CFIm68 RRM heterotetramer illustrated that CFIm25 homodimer is clamped by two CFIm68 monomers on each side of the dimer interface.
20695905 Data provide evidence that CFIm exists as a heterotetramer of 25-kD, 59-kD and 68-kD subunits of CFIm: CFIm25, CFIm59 and CFIm68.
20479262 crystal structures of the CFI(m)25 homodimer in complex with UGUAAA and UUGUAU RNA sequences
20479262 Crystallographic and biochemical experiments suggest that CF I(m)25 specifically recognizes UGUA RNA sequence and binds to two UGUA simultaneously
18767156 The crystal structure of human CPSF5 was solved at 1.9 A resolution.
18445629 Results from crystallographic and biochemical experiments suggest that CF I(m)25 makes use of its Nudix fold to bind but not hydrolyze ATP and diadenosine tetraphosphate.
17098938 Evidence that CFIm25 regulates alternative poly(A) site selection of genes with tandem poly(A) signals in their 3'-UTRs.
15169763 region in the subunit of CF I(m) involved in RNA binding, protein-protein interactions, and subcellular localization

AA Sequence

MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREE      1 - 70
FDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWV     71 - 140
IDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGP    141 - 210
IISSLPQLLSRFNFIYN                                                         211 - 227
//

Text Mined References (43)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26312503 2015 NUDT21-spanning CNVs lead to neuropsychiatric disease and altered MeCP2 abundance via alternative polyadenylation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
22960638 2012 Alternative 3'-end processing of long noncoding RNA initiates construction of nuclear paraspeckles.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21295486 2011 Crystal structure of a human cleavage factor CFI(m)25/CFI(m)68/RNA complex provides an insight into poly(A) site recognition and RNA looping.
21269460 2011 Initial characterization of the human central proteome.
20695905 2010 Evidence that cleavage factor Im is a heterotetrameric protein complex controlling alternative polyadenylation.
20479262 2010 Structural basis of UGUA recognition by the Nudix protein CFI(m)25 and implications for a regulatory role in mRNA 3' processing.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18767156 2008 The crystal structure of human cleavage and polyadenylation specific factor-5 reveals a dimeric Nudix protein with a conserved catalytic site.
18445629 2008 Crystal structure of the 25 kDa subunit of human cleavage factor Im.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17172643 2007 Multiple histone deacetylases and the CREB-binding protein regulate pre-mRNA 3'-end processing.
17098938 2006 Knock-down of 25 kDa subunit of cleavage factor Im in Hela cells alters alternative polyadenylation within 3'-UTRs.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15635413 2005 Nucleolar proteome dynamics.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15169763 2004 Distinct sequence motifs within the 68-kDa subunit of cleavage factor Im mediate RNA binding, protein-protein interactions, and subcellular localization.
14690600 2003 A mechanism for the regulation of pre-mRNA 3' processing by human cleavage factor Im.
14561889 2003 Association of polyadenylation cleavage factor I with U1 snRNP.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11716503 2001 Interaction of poly(A) polymerase with the 25-kDa subunit of cleavage factor I.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11060040 2000 Human pre-mRNA cleavage factor II(m) contains homologs of yeast proteins and bridges two other cleavage factors.
9659921 1998 Human pre-mRNA cleavage factor Im is related to spliceosomal SR proteins and can be reconstituted in vitro from recombinant subunits.
8626397 1996 Purification and characterization of human cleavage factor Im involved in the 3' end processing of messenger RNA precursors.