Property Summary

NCBI Gene PubMed Count 23
PubMed Score 18.75
PubTator Score 16.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Mammary Neoplasms 410
Disease Target Count P-value
osteosarcoma 7933 3.4e-05
psoriasis 6685 5.7e-05
lung cancer 4473 7.2e-04
inflammatory breast cancer 404 4.7e-03
Disease Target Count Z-score Confidence
cartilage-hair hypoplasia 7 4.175 2.1

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -2.100 5.7e-05
osteosarcoma -1.991 3.4e-05
lung cancer 1.600 7.2e-04
inflammatory breast cancer -1.200 4.7e-03

Gene RIF (6)

PMID Text
23384440 This paper presents the crystal structure of wild-type and E58A mutant human Ap4A hydrolase.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20533549 High NUDT2 is associated with breast carcinoma.
20144233 In this study the authors present data demonstrating that the SARS-CoV 7a protein interacts with human Ap4A-hydrolase (asymmetrical diadenosine tetraphosphate hydrolase, EC 3.6.1.17).
15772762 NMR resonance assignments
15596429 crystallographic structure and substrate-binding mechanism of Ap4A hydrolase

AA Sequence

MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQL      1 - 70
TIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQ     71 - 140
FLCSIEA                                                                   141 - 147
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23384440 2013 Crystal structure of wild-type and mutant human Ap4A hydrolase.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20533549 2011 Nudix-type motif 2 in human breast carcinoma: a potent prognostic factor associated with cell proliferation.
20144233 2010 SARS coronavirus protein 7a interacts with human Ap4A-hydrolase.
15772762 2005 1H, 13C, and 15N resonance assignments of the 17 kDa Ap4A hydrolase from Homo sapiens in the presence and absence of ATP.
15596429 2005 Structure and substrate-binding mechanism of human Ap4A hydrolase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12767470 2003 Metabolic transformation of AZTp4A by Ap4A hydrolase regenerates AZT triphosphate.
12673352 2003 Selective splitting of 3'-adenylated dinucleoside polyphosphates by specific enzymes degrading dinucleoside polyphosphates.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11937063 2002 The crystal structure of diadenosine tetraphosphate hydrolase from Caenorhabditis elegans in free and binary complex forms.
11738085 2001 Cloning, characterisation and crystallisation of a diadenosine 5',5"'-P(1),P(4)-tetraphosphate pyrophosphohydrolase from Caenorhabditis elegans.
10620341 2000 Selective degradation of 2'-adenylated diadenosine tri- and tetraphosphates, Ap(3)A and Ap(4)A, by two specific human dinucleoside polyphosphate hydrolases.
10452553 1999 Ap4A induces apoptosis in human cultured cells.
9650578 1998 Potent inhibition of specific diadenosine polyphosphate hydrolases by suramin.
9479504 1998 Chromosomal localization of the human diadenosine 5',5"'-P1,P4-tetraphosphate pyrophosphohydrolase (Ap4A hydrolase) gene (APAH1) to 9p13.
8810257 1996 The MutT proteins or "Nudix" hydrolases, a family of versatile, widely distributed, "housecleaning" enzymes.
8381042 1993 Human placental (Asymmetrical) diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase: purification to homogeneity and some properties.
7767787 1995 Diadenosine 5',5"'-P1,P4-tetraphosphate hydrolase is present in human erythrocytes, leukocytes and platelets.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
7487923 1995 Human diadenosine 5',5"'-P1,P4-tetraphosphate pyrophosphohydrolase is a member of the MutT family of nucleotide pyrophosphatases.
1652465 1991 Dinucleoside tetraphosphatase from human blood cells. Purification and characterization as a high specific activity enzyme recognized by an anti-rat tetraphosphatase antibody.