Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.53
PubTator Score 0.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.1e-12

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -3.576 1.1e-12

 Compartment GO Term (2)

AA Sequence

MAEVRVQLLLSRRPESVSFARSVCGLLGAGPGLGTWPIHCSLKRGRLVLSSRPFPGASARLPLQRPPFCP      1 - 70
FAALEERPRVPGAELPTDRGVDLGVAVILQSSDKTVLLTRRARTLSVSPNLWVPPGGHVELEEELLDGGL     71 - 140
RELWEESGLHLPQGQFSWVPLGLWESAYPPRLSWGLPKYHHIVLYLLVISQESQQQLQARIQPNPNEVSA    141 - 210
LMWLTPDVAAAVAAAEDGTETPGLLPQDLPPSVLAVELEEDGRARPLVLHMSTLLRMIPTMAEDKERVST    211 - 280
GTKFALKLWLQHLGRTPPPCKSAAYLDPGPAKEEWNMDPLPPNQGSGK                          281 - 328
//

Text Mined References (4)

PMID Year Title