Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.20
PubTator Score 0.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 1.1e-12

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -3.576 1.1e-12

Synonym

Accession P0C025 Nudix motif 17
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 Compartment GO Term (2)

AA Sequence

MAEVRVQLLLSRRPESVSFARSVCGLLGAGPGLGTWPIHCSLKRGRLVLSSRPFPGASARLPLQRPPFCP      1 - 70
FAALEERPRVPGAELPTDRGVDLGVAVILQSSDKTVLLTRRARTLSVSPNLWVPPGGHVELEEELLDGGL     71 - 140
RELWEESGLHLPQGQFSWVPLGLWESAYPPRLSWGLPKYHHIVLYLLVISQESQQQLQARIQPNPNEVSA    141 - 210
LMWLTPDVAAAVAAAEDGTETPGLLPQDLPPSVLAVELEEDGRARPLVLHMSTLLRMIPTMAEDKERVST    211 - 280
GTKFALKLWLQHLGRTPPPCKSAAYLDPGPAKEEWNMDPLPPNQGSGK                          281 - 328
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.