Property Summary

NCBI Gene PubMed Count 16
PubMed Score 22.49
PubTator Score 13.40

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.800 9.4e-03
glioblastoma -1.200 2.7e-03
intraductal papillary-mucinous neoplasm ... 1.200 1.7e-03
lung cancer 1.600 7.5e-03
adult high grade glioma -1.100 1.6e-03
ovarian cancer 1.800 7.4e-05

Gene RIF (8)

PMID Text
26878724 Patients with defective NUDT15 alleles showed excessive levels of thiopurine active metabolites and toxicity. [meta-analysis]
26405151 NUDT15 c.415C>T increases risk of 6-mercaptopurine induced myelosuppression during maintenance therapy in children with acute lymphoblastic leukemia.
26238318 Depletion of NUDT15 has no effect on incorporation of 8-oxo-dGTP into DNA and does not impact cancer cell survival in cell lines tested. NUDT15 is not a biologically relevant 8-oxo-dGTPase
26033531 Event-free survival did not significantly differ by NUDT15 genotype. rs116855232 is an important determinant of 6-MP myelotoxicity in Japanese children with ALL and may represent the most robust toxicity-related locus in Asians to date.
25624441 Describe a germline variant in NUDT15 strongly associated with mercaptopurine intolerance in childhood acute lymphoblastic leukemia, which may have implications for treatment individualization in this disease.
25108385 Authros identified a nonsynonymous SNP in NUDT15 (encoding p.Arg139Cys) that was strongly associated with thiopurine-induced early leukopenia (odds ratio (OR) = 35.6; P(combined) = 4.88 x 10(-94)).
20144704 human MTH1, MTH2, and NUDT5 proteins act as a defense against the mutagenesis induced by oxidized dGTP.
19419956 Data demonstrate for the first time that PCNA is protected by this newly identified partner molecule MTH2, which is related to DNA synthesis and cell cycle progression.

AA Sequence

MTASAQPRGRRPGVGVGVVVTSCKHPRCVLLGKRKGSVGAGSFQLPGGHLEFGETWEECAQRETWEEAAL      1 - 70
HLKNVHFASVVNSFIEKENYHYVTILMKGEVDVTHDSEPKNVEPEKNESWEWVPWEELPPLDQLFWGLRC     71 - 140
LKEQGYDPFKEDLNHLVGYKGNHL                                                  141 - 164
//

Text Mined References (18)

PMID Year Title
26878724 2016 NUDT15 polymorphisms alter thiopurine metabolism and hematopoietic toxicity.
26405151 2016 NUDT15 c.415C>T increases risk of 6-mercaptopurine induced myelosuppression during maintenance therapy in children with acute lymphoblastic leukemia.
26238318 2015 Crystal structure, biochemical and cellular activities demonstrate separate functions of MTH1 and MTH2.
26067482 2015 Update on thiopurine pharmacogenetics in inflammatory bowel disease.
26033531 2015 Susceptibility to 6-MP toxicity conferred by a NUDT15 variant in Japanese children with acute lymphoblastic leukaemia.
25624441 2015 Inherited NUDT15 variant is a genetic determinant of mercaptopurine intolerance in children with acute lymphoblastic leukemia.
25108385 2014 A common missense variant in NUDT15 confers susceptibility to thiopurine-induced leukopenia.
22556419 2012 Human MTH3 (NUDT18) protein hydrolyzes oxidized forms of guanosine and deoxyguanosine diphosphates: comparison with MTH1 and MTH2.
21269460 2011 Initial characterization of the human central proteome.
20144704 2010 Suppression of mutagenesis by 8-hydroxy-2'-deoxyguanosine 5'-triphosphate (7,8-dihydro-8-oxo-2'-deoxyguanosine 5'-triphosphate) by human MTH1, MTH2, and NUDT5.
19419956 2009 Proliferating cell nuclear antigen is protected from degradation by forming a complex with MutT Homolog2.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12767940 2003 Mouse MTH2 protein which prevents mutations caused by 8-oxoguanine nucleotides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8810257 1996 The MutT proteins or "Nudix" hydrolases, a family of versatile, widely distributed, "housecleaning" enzymes.