Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.77
PubTator Score 19.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -3.600 2.0e-07
psoriasis -1.100 2.6e-02
glioblastoma multiforme -1.100 2.2e-15
astrocytoma -1.900 4.8e-02
non-small cell lung cancer 1.311 2.3e-08
intraductal papillary-mucinous adenoma (... -1.700 1.0e-04
intraductal papillary-mucinous carcinoma... -1.800 1.9e-04
intraductal papillary-mucinous neoplasm ... -1.400 9.1e-03
Pick disease -1.600 9.3e-03
acute myeloid leukemia -2.000 1.0e-02

Synonym

Accession Q96G61 Q9NVN0 DIPP-3-beta
Symbols APS1
ASP1
DIPP3b
DIPP3beta
hDIPP3beta

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

PMID Text
22730461 NUDT11, HNF1B, and SLC22A3 genes have roles in prostate cancer pathogenesis
21071540 Observational study of gene-disease association. (HuGE Navigator)
19902474 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of nudix (nucleoside diphosphate linked moiety X)-type motif 11 (NUDT11) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
12121577 Cloning and characterisation of NUDT11 as a diadenosine polyphosphate-metabolising Nudix hydrolase.
12105228 The NUDT11 gene, located on chromosome X, is preferentially expressed in the testis

AA Sequence

MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEA      1 - 70
GVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYL     71 - 140
EKLKLGGSPTNGNSMAPSSPDSDP                                                  141 - 164
//

Text Mined References (18)

PMID Year Title
22730461 2012 Genetic and functional analyses implicate the NUDT11, HNF1B, and SLC22A3 genes in prostate cancer pathogenesis.
21269460 2011 Initial characterization of the human central proteome.
21071540 2011 Validation of genome-wide prostate cancer associations in men of African descent.
19902474 2010 Replication of prostate cancer risk loci on 8q24, 11q13, 17q12, 19q33, and Xp11 in African Americans.
18264098 2008 Common sequence variants on 2p15 and Xp11.22 confer susceptibility to prostate cancer.
18264097 2008 Multiple newly identified loci associated with prostate cancer susceptibility.
16381901 2006 The LIFEdb database in 2006.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370170 2002 Nudix hydrolases that degrade dinucleoside and diphosphoinositol polyphosphates also have 5-phosphoribosyl 1-pyrophosphate (PRPP) pyrophosphatase activity that generates the glycolytic activator ribose 1,5-bisphosphate.
12121577 2002 Cloning and characterisation of hAps1 and hAps2, human diadenosine polyphosphate-metabolising Nudix hydrolases.
12105228 2002 An adjacent pair of human NUDT genes on chromosome X are preferentially expressed in testis and encode two new isoforms of diphosphoinositol polyphosphate phosphohydrolase.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.