Property Summary

NCBI Gene PubMed Count 12
PubMed Score 47.30
PubTator Score 30.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 4.0e-04
Breast cancer -1.400 9.9e-04
glioblastoma -1.100 1.3e-02
medulloblastoma, large-cell -1.200 1.5e-02
osteosarcoma 1.186 5.2e-04
psoriasis -1.200 6.2e-29
sonic hedgehog group medulloblastoma 1.100 4.4e-04

Gene RIF (4)

AA Sequence

MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEA      1 - 70
GVKGKLGRLLGVFEQNQDPKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYL     71 - 140
EKLKLGGSPTNGNSMAPSSPDSDP                                                  141 - 164
//

Text Mined References (14)

PMID Year Title