Property Summary

NCBI Gene PubMed Count 12
PubMed Score 46.31
PubTator Score 30.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.186 5.2e-04
atypical teratoid / rhabdoid tumor -1.100 4.0e-04
glioblastoma -1.100 1.3e-02
medulloblastoma, large-cell -1.200 1.5e-02
sonic hedgehog group medulloblastoma 1.100 4.4e-04
Breast cancer -1.400 9.9e-04
psoriasis -1.200 6.2e-29

Synonym

Accession Q8NFP7 A8K7D7 D3DX69 Q86VK1 Q86VR0 DIPP-3-alpha
Symbols APS2
DIPP3a
DIPP3-alpha

Gene

PANTHER Protein Class (2)

PDB

3MCF  

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (4)

PMID Text
21071540 Observational study of gene-disease association. (HuGE Navigator)
20564319 Meta-analysis of gene-disease association. (HuGE Navigator)
12121577 Cloning and characterisation of NUDT10 as a diadenosine polyphosphate-metabolising Nudix hydrolase.
12105228 The NUDT10 gene, located on chromosome X, is preferentially expressed in the testis

AA Sequence

MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEA      1 - 70
GVKGKLGRLLGVFEQNQDPKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYL     71 - 140
EKLKLGGSPTNGNSMAPSSPDSDP                                                  141 - 164
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21269460 2011 Initial characterization of the human central proteome.
21071540 2011 Validation of genome-wide prostate cancer associations in men of African descent.
20564319 2010 Prostate cancer risk-associated variants reported from genome-wide association studies: meta-analysis and their contribution to genetic Variation.
18264098 2008 Common sequence variants on 2p15 and Xp11.22 confer susceptibility to prostate cancer.
18264097 2008 Multiple newly identified loci associated with prostate cancer susceptibility.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370170 2002 Nudix hydrolases that degrade dinucleoside and diphosphoinositol polyphosphates also have 5-phosphoribosyl 1-pyrophosphate (PRPP) pyrophosphatase activity that generates the glycolytic activator ribose 1,5-bisphosphate.
12121577 2002 Cloning and characterisation of hAps1 and hAps2, human diadenosine polyphosphate-metabolising Nudix hydrolases.
12105228 2002 An adjacent pair of human NUDT genes on chromosome X are preferentially expressed in testis and encode two new isoforms of diphosphoinositol polyphosphate phosphohydrolase.