Property Summary

NCBI Gene PubMed Count 77
PubMed Score 223.56
PubTator Score 164.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis 1.600 5.3e-05
glioblastoma 1.400 7.3e-07
group 3 medulloblastoma 2.300 4.0e-05
medulloblastoma, large-cell 1.500 1.9e-04
adrenocortical carcinoma 1.010 4.9e-03
non-small cell lung cancer 1.522 2.8e-16
lung cancer 1.500 6.2e-04
pediatric high grade glioma 1.300 3.3e-05
non primary Sjogren syndrome sicca 1.100 2.0e-02
gastric carcinoma 1.500 3.5e-02
ovarian cancer 1.400 2.0e-04

Protein-protein Interaction (3)

Gene RIF (59)

PMID Text
26755138 activity of MTH1 in different breast cancer cell lines has been detected, implying the potential application of this assay method for biomedical research and clinical diagnose in the future
26520386 Results show that MTH1 plays no role in protecting the cells against ultraviolet radiation-induced cytogenetic damage.
26238318 MTH1 is the most prominent sanitizer of the cellular dNTP pool known to date.
26202347 a novel approach involving liquid chromatography-isotope-dilution tandem mass spectrometry to positively identify and accurately quantify MTH1 in human tissues, is reported.
25893378 MTH1 expression is required for effective transformation of epithelial cells by oncogenic HRAS.
25127756 Data suggest that hOGG1 could compensate for hMTH1 during oxidative DNA damage caused by H2O2, whereas hMTH1 could not compensate sufficiently for hOGG1 during the process.
25023700 results indicate MTH1 is a novel and critical component of oncogenic KRAS-associated malignancy and its inhibition is likely to yield significant tumor-suppressive outcomes in KRAS-driven tumors.
24928220 The ectopic expression of hMTH1 in the chloroplasts and mitochondria of Arabidopsis enhanced oxidative stress tolerance by activating the poly(ADP-ribosyl)ation (PAR)reaction and suppressing programmed cell death.
24695224 cancer cells require MTH1 activity to avoid incorporation of oxidized dNTPs, resulting in DNA damage and cell death; validation of MTH1 as an anticancer target in vivo
24144844 MTH1 protects cells from mutagenesis induced by ultraviolet ray A and B, but not ultraviolet ray C.hMTH1 prevents induction of transition-type mutations at AT and GC post ultraviolet ray A irradiation.
23396182 The risk of type 2 diabetes in the Chinese population is increased from the combined effects of AluYb8MUTYH with either hMTH1 c.247G>A or variants in the 5\'-UTR of the hOGG1.
23295485 X-ray crystallographic analysis of MTH1 protein structure
22974734 Results suggest that the hMTH1-mediated maintenance of mtDNA stability protects cells from the susceptibility to oxidant injury associated with polyQ-expanded Htt, defends against 3-nitropropionic acid-induced neurodegeneration
22841817 MutT homolog-1 attenuates oxidative DNA damage and delays photoreceptor cell death in inherited retinal degeneration.
22790201 The study provides insight into the influence of MTH1 levels on the epithelial-mesenchymal transition phenotype and Akt activation in RAS-transformed HMLE breast epithelial cells.
21787772 the structures of human MTH1 (1.9A) and its complex with the product 8-oxo-dGMP
21784087 results indicate that the nucleotide pool is a significant target for UVA-induced mutations and implicates that hMTH1 plays an important role in protecting cells from UVA-induced oxidative stress
21538080 These results suggest that MTH1 deficiency might be a causative factor for aging and age-related disorders.
21421019 The expression levels of hMTH1 mRNA are highly correlated with hepatic levels of 8-oxo-dG and tail moment, suggesting that hMTH1 gene expression represents a molecular marker of oxidative DNA damage.
21355073 Two rare variants (OGG1 c.137G>A; MUTYH c.1187G>A) and one common polymorphism (NUDT1 c.426C>T) were associated with colorectal cancer risk.
21289483 Manipulation of miR-145 expression modulates epidermal growth factor receptor (EGFR) and NUDT1 mRNA expressions.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20144704 human MTH1, MTH2, and NUDT5 proteins act as a defense against the mutagenesis induced by oxidized dGTP.
18848840 Single nucleotide polymorphisms (SNPs) in hMTH1, hOGG1 and hMYH genes are associated with risk of chronic benzene poisoning.
18848840 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18776649 These results suggest that the single nucleotide polymorphisms of OGG1 and MTH1 may be cause of 8-hydroxy-2'-deoxyguanosine accumulation in the gastric mucosa.
18708163 hMTH1 plays an important role in protecting cells against H(2)O(2)-induced apoptosis via a Noxa- and caspase-3/7-mediated signaling pathway, thus conferring a survival advantage through the inhibition of oxidative-stress-induced DNA damage
18515411 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18510611 Observational study of gene-disease association. (HuGE Navigator)
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18091433 Observational study of gene-disease association. (HuGE Navigator)
17917452 Observational study of gene-disease association. (HuGE Navigator)
17917452 These results suggested to us that the Thr45 allele of MTH1 might be associated with sporadic PD in the Chinese male population.
17417778 Observational study of gene-disease association. (HuGE Navigator)
17252231 Observational study of gene-disease association. (HuGE Navigator)
17207658 Observational study of gene-disease association. (HuGE Navigator)
17142918 Crystals of hMTH1-8-oxo-dGMP and hMTH1-2-oxo-dATP were diffracted at resolutions of 1.95 and 2.22 A, respectively.
16774934 Observational study of gene-disease association. (HuGE Navigator)
16774934 In a case-control study, single nucleotide polymorphism of MTH1 was associated with increased small cell lung cancer risk.
16607562 The amino terminal region of MTH1a functioned as a mitochondrial targeting signal when it was expressed in the HeLa cells as a fusion protein with enhanced green fluorescent protein.
16600130 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15931596 Observational study of gene-disease association. (HuGE Navigator)
15730954 Observational study of genotype prevalence. (HuGE Navigator)
15654505 Observational study of gene-disease association. (HuGE Navigator)
15516784 Observational study of gene-disease association. (HuGE Navigator)
15516784 the Met allele at codon 83 of MTH1 gene might be involved in the development of type 1 diabetes mellitus in the Japanese female population.
15449173 Observational study of gene-disease association. (HuGE Navigator)
15133035 study presents the solution structure of Nudix family hydrolase MTH1 solved by multidimensional heteronuclear NMR spectroscopy
15095864 These results clarify the effects of the anti/syn conformation and the functional groups on the 2 and 6 positions of the purine ring on the recognition by the human MTH1 protein.
14634838 Observational study of genotype prevalence. (HuGE Navigator)
12957652 dGDP and dADP, at physiological concentrations not exceeding 5 microM and GDP at mean concentration of 30 microM, taken together, can decrease the cellular hMTH1 enzymatic activity vs. 8-oxo-dGTP
12857738 MTH1 protects cells from H2O2-induced cell dysfunction and death by hydrolyzing oxidized purine nucleotides including 8-oxo-dGTP and 2-OH-dATP.
12757855 Elevated levels of hMTH1 protein is asociated with non-small-cell lung carcinomas
12717453 cleaves 8-oxo-dGTP to 8-oxo-GMP, an unusable form for DNA synthesis
12619034 These results suggested that increased expression of hMTH in peripheral lymphocytes may be a risk factor for prostate cancer and support our priori hypothesis.
12051941 Role of tryptophan residues in the recognition of mutagenic oxidized nucleotides by human antimutator MTH1 protein
11852070 8-Chloro-dGTP, a hypochlorous acid-modified nucleotide, is hydrolyzed by hMTH1, the human MutT homolog.
11756418 Trp-117 is essential for MTH1 to recognize both 8-oxo-dGTP and 2-hydroxy-dATP, whereas Asp-119 is only essential for recognizing 2-hydroxy-dATP, thus suggesting that origins of the substrate-binding pockets for MTH1 and MutT are different
11136354 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MYWSNQITRRLGERVQGFMSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGA      1 - 70
GRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESD     71 - 140
EMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV                 141 - 197
//

Text Mined References (79)

PMID Year Title
26755138 2016 Investigation of MTH1 activity via mismatch-based DNA chain elongation.
26520386 2015 Investigation of micronucleus induction in MTH1 knockdown cells exposed to UVA, UVB or UVC.
26238318 2015 Crystal structure, biochemical and cellular activities demonstrate separate functions of MTH1 and MTH2.
26202347 2015 Addiction to MTH1 protein results in intense expression in human breast cancer tissue as measured by liquid chromatography-isotope-dilution tandem mass spectrometry.
25893378 2015 MTH1 expression is required for effective transformation by oncogenic HRAS.
25416956 2014 A proteome-scale map of the human interactome network.
25127756 2014 Compensatory effects of hOGG1 for hMTH1 in oxidative DNA damage caused by hydrogen peroxide.
25023700 2015 MutT Homolog 1 (MTH1) maintains multiple KRAS-driven pro-malignant pathways.
24928220 2014 Ectopic expression of the human MutT-type Nudix hydrolase, hMTH1, confers enhanced tolerance to oxidative stress in arabidopsis.
24695225 2014 Stereospecific targeting of MTH1 by (S)-crizotinib as an anticancer strategy.
24695224 2014 MTH1 inhibition eradicates cancer by preventing sanitation of the dNTP pool.
24144844 Analysis of mutant frequencies and mutation spectra in hMTH1 knockdown TK6 cells exposed to UV radiation.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23396182 2013 Combined analysis of polymorphism variants in hMTH1, hOGG1 and MUTYH genes on the risk of type 2 diabetes in the Chinese population.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23295485 2013 Crystallization and preliminary X-ray analysis of human MTH1 with a homogeneous N-terminus.
22974734 2013 hMTH1 expression protects mitochondria from Huntington's disease-like impairment.
22841817 2012 MutT homolog-1 attenuates oxidative DNA damage and delays photoreceptor cell death in inherited retinal degeneration.
22790201 Human Mut T Homolog 1 (MTH1): a roadblock for the tumor-suppressive effects of oncogenic RAS-induced ROS.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
22556419 2012 Human MTH3 (NUDT18) protein hydrolyzes oxidized forms of guanosine and deoxyguanosine diphosphates: comparison with MTH1 and MTH2.
21787772 2011 Crystal structure of human MTH1 and the 8-oxo-dGMP product complex.
21784087 2011 Reduction of 8-oxodGTP in the nucleotide pool by hMTH1 leads to reduction in mutations in the human lymphoblastoid cell line TK6 exposed to UVA.
21538080 2011 Oxidative damage to RNA and expression patterns of MTH1 in the hippocampi of senescence-accelerated SAMP8 mice and Alzheimer's disease patients.
21421019 2011 Lycopene inhibits DNA damage and reduces hMTH1 mRNA expression in the liver of Mongolian gerbils treated with ferric nitrilotriacetate.
21355073 2011 Analysis of the oxidative damage repair genes NUDT1, OGG1, and MUTYH in patients from mismatch repair proficient HNPCC families (MSS-HNPCC).
21289483 MiR-145 inhibits cell proliferation of human lung adenocarcinoma by targeting EGFR and NUDT1.
21269460 2011 Initial characterization of the human central proteome.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20144704 2010 Suppression of mutagenesis by 8-hydroxy-2'-deoxyguanosine 5'-triphosphate (7,8-dihydro-8-oxo-2'-deoxyguanosine 5'-triphosphate) by human MTH1, MTH2, and NUDT5.
18848840 2008 Genetic polymorphisms in hMTH1, hOGG1 and hMYH and risk of chronic benzene poisoning in a Chinese occupational population.
18776649 2008 OGG1, MYH and MTH1 gene variants identified in gastric cancer patients exhibiting both 8-hydroxy-2'-deoxyguanosine accumulation and low inflammatory cell infiltration in their gastric mucosa.
18708163 2008 hMTH1 depletion promotes oxidative-stress-induced apoptosis through a Noxa- and caspase-3/7-mediated signaling pathway.
18515411 2008 Inherited predisposition to colorectal adenomas caused by multiple rare alleles of MUTYH but not OGG1, NUDT1, NTH1 or NEIL 1, 2 or 3.
18510611 2008 Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
18091433 2007 Heterogeneous molecular mechanisms underlie attenuated familial adenomatous polyposis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17917452 2008 Association study of human MTH1 Ile45Thr polymorphism with sporadic Parkinson's disease.
17417778 2007 Genetic investigation of DNA-repair pathway genes PMS2, MLH1, MSH2, MSH6, MUTYH, OGG1 and MTH1 in sporadic colon cancer.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17252231 2007 MYH, OGG1, MTH1, and APC alterations involved in the colorectal tumorigenesis of Korean patients with multiple adenomas.
17207658 2007 Analysis of the base excision repair genes MTH1, OGG1 and MUTYH in patients with squamous oral carcinomas.
17142918 2006 Crystallization and preliminary X-ray analysis of human MTH1 complexed with two oxidized nucleotides, 8-oxo-dGMP and 2-oxo-dATP.
16774934 2006 Association of polymorphisms in the MTH1 gene with small cell lung carcinoma risk.
16607562 2006 The GT to GC single nucleotide polymorphism at the beginning of an alternative exon 2C of human MTH1 gene confers an amino terminal extension that functions as a mitochondrial targeting signal.
16600130 2006 [Relationship between genetic polymorphism in hMTH1c.83, hOGG1c.326 and hMYHc.335 and risks of chronic benzene poisoning].
15931596 2005 Germline susceptibility to colorectal cancer due to base-excision repair gene defects.
15730954 2005 [Genetic polymorphisms of nucleotide repair gene hMTH1 in southern Chinese Han population].
15654505 2005 Association of habitual smoking and drinking with single nucleotide polymorphism (SNP) in 40 candidate genes: data from random population-based Japanese samples.
15516784 2004 Association study of human MTH1 gene polymorphisms with type 1 diabetes mellitus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15449173 2004 Mutational analysis of OGG1, MYH, MTH1 in FAP, HNPCC and sporadic colorectal cancer patients: R154H OGG1 polymorphism is associated with sporadic colorectal cancer patients.
15133035 2004 Structure of human MTH1, a Nudix family hydrolase that selectively degrades oxidized purine nucleoside triphosphates.
15095864 2004 Probing the substrate recognition mechanism of the human MTH1 protein by nucleotide analogs.
14634838 2003 Allele frequencies of single nucleotide polymorphisms (SNPs) in 40 candidate genes for gene-environment studies on cancer: data from population-based Japanese random samples.
12957652 2003 Inhibition of 8-oxo-2'-deoxyguanosine 5'-triphosphate pyrophosphohydrolase (8-oxo-dGTPase) activity of the antimutagenic human MTH1 protein by nucleoside 5'-diphosphates.
12903117 2002 Substrate recognition by the human MTH1 protein.
12857738 2003 An oxidized purine nucleoside triphosphatase, MTH1, suppresses cell death caused by oxidative stress.
12853948 2003 The DNA sequence of human chromosome 7.
12757855 2003 Expression of human MutT homologue (hMTH1) protein in primary non-small-cell lung carcinomas and histologically normal surrounding tissue.
12717453 2003 A novel mechanism for preventing mutations caused by oxidation of guanine nucleotides.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12619034 2003 Overexpression of hMTH in peripheral lymphocytes and risk of prostate cancer: a case-control analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12051941 2002 Role of tryptophan residues in the recognition of mutagenic oxidized nucleotides by human antimutator MTH1 protein.
12051680 2002 Renal excretion of 8-oxo-7,8-dihydro-2(')-deoxyguanosine: degradation rates of RNA and metabolic rate in humans.
11756418 2002 A molecular basis for the selective recognition of 2-hydroxy-dATP and 8-oxo-dGTP by human MTH1.
11572992 2001 Spontaneous tumorigenesis in mice defective in the MTH1 gene encoding 8-oxo-dGTPase.
11139615 2001 Human MTH1 protein hydrolyzes the oxidized ribonucleotide, 2-hydroxy-ATP.
11136354 2000 A valine to methionine polymorphism at codon 83 in the 8-oxo-dGTPase gene MTH1 is not associated with sporadic Parkinson's disease.
10608900 1999 Functional significance of the conserved residues for the 23-residue module among MTH1 and MutT family proteins.
10536140 1999 Multi-forms of human MTH1 polypeptides produced by alternative translation initiation and single nucleotide polymorphism.
10373420 1999 The oxidized forms of dATP are substrates for the human MutT homologue, the hMTH1 protein.
9211940 1997 Regulation of expression of the human MTH1 gene encoding 8-oxo-dGTPase. Alternative splicing of transcription products.
8226881 1993 Cloning and expression of cDNA for a human enzyme that hydrolyzes 8-oxo-dGTP, a mutagenic substrate for DNA synthesis.
7782328 1995 Intracellular localization of 8-oxo-dGTPase in human cells, with special reference to the role of the enzyme in mitochondria.
7713500 1994 Genomic structure and chromosome location of the human mutT homologue gene MTH1 encoding 8-oxo-dGTPase for prevention of A:T to C:G transversion.
7713494 1994 Chromosomal location and some structural features of human clathrin light-chain genes (CLTA and CLTB).