Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.45
PubTator Score 4.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.379 8.8e-05
ependymoma -1.200 1.7e-13
atypical teratoid / rhabdoid tumor -1.500 1.1e-08
glioblastoma -1.100 2.3e-05
medulloblastoma -1.100 9.4e-08
medulloblastoma, large-cell -1.500 1.6e-05
primitive neuroectodermal tumor -1.100 4.4e-05

Synonym

Accession Q8IVD9 Q9BTI3 Q9H7W9 Q9UPT4
Symbols NudCL

Gene

PDB

1WGV  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19806165 overexpression of NudCL inhibits cytokinesis
16754861 Data characterize a previously undescribed mammalian NudC-like protein (NudCL), which appears to influence the stabilization of dynein intermediate chain

AA Sequence

METGAAELYDQALLGILQHVGNVQDFLRVLFGFLYRKTDFYRLLRHPSDRMGFPPGAAQALVLQVFKTFD      1 - 70
HMARQDDEKRRQELEEKIRRKEEEEAKTVSAAAAEKEPVPVPVQEIEIDSTTELDGHQEVEKVQPPGPVK     71 - 140
EMAHGSQEAEAPGAVAGAAEVPREPPILPRIQEQFQKNPDSYNGAVRENYTWSQDYTDLEVRVPVPKHVV    141 - 210
KGKQVSVALSSSSIRVAMLEENGERVLMEGKLTHKINTESSLWSLEPGKCVLVNLSKVGEYWWNAILEGE    211 - 280
EPIDIDKINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWDAEGSPFRGQRFDPA    281 - 350
MFNISPGAVQF                                                               351 - 361
//

Text Mined References (20)

PMID Year Title
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20562859 2010 Network organization of the human autophagy system.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19806165 2009 Inhibition of cytokinesis by overexpression of NudCL that is localized to the centrosome and midbody.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16754861 2006 A mammalian NudC-like protein essential for dynein stability and cell viability.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9847074 1998 Toward a complete human genome sequence.