Property Summary

NCBI Gene PubMed Count 43
PubMed Score 25.75
PubTator Score 27.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
pancreatic cancer -1.300 1.2e-02
Waldenstrons macroglobulinemia 1.564 2.0e-03
Multiple myeloma 1.122 1.0e-02
osteosarcoma 1.163 1.1e-03
atypical teratoid / rhabdoid tumor -1.200 2.9e-04
medulloblastoma, large-cell -1.300 5.8e-04
hereditary spastic paraplegia -1.067 1.8e-02
juvenile dermatomyositis 1.085 1.6e-05
pancreatic ductal adenocarcinoma liver m... -1.735 4.8e-02
Breast cancer 2.500 4.5e-02
adult high grade glioma -1.500 2.3e-03
group 4 medulloblastoma 1.300 2.3e-02
pancreatic carcinoma -1.300 1.2e-02
subependymal giant cell astrocytoma -2.138 3.5e-02
nasopharyngeal carcinoma 1.100 6.5e-05
ovarian cancer -1.300 5.0e-05

Synonym

Accession Q9H1E3 Q54AC0 Q5PXE7 Q9H1D6 Q9H723
Symbols JC7
NUCKS

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (20)

PMID Text
26968889 NUCKS1 was identified as a potential oncogene at chromosomal 1q32.1 in patients with HCC, and it might be a valuable immunodiagnostic marker for HCC
26323318 The results show that NUCKS1 is a chromatin-associated protein with a role in the DNA damage response and in homologous recombination, a DNA repair pathway critical for tumor suppression.
25119009 We would like to emphasize that NUCKS abundance in malignant skin tumors is higher than that of the well-known proliferation marker Ki67, thus allowing more precise assessment of tumor proliferation potential.
25116364 NUCKS1 expression did not increase Tat nuclear localization.
25116364 Overexpression of NUCKS1 moderately induces HIV-1 production with increased release of p24 without PMA stimulation in latently infected cells
24931609 NUCKS is a physiological regulator of energy homeostasis and glucose metabolism that works by regulating chromatin accessibility and RNA polymerase II recruitment to the promoters of IR and other insulin pathway modulators.
24819170 NUCKS1 overexpression may be associated with tumour progression and recurrence in cervical squamous cell carcinoma
24568505 NUCKS-1 overexpression is associated with obesity and with breast cancer.
24284105 Authors suggest that NUCKS is involved in cellular responses following PDT.
24140890 The expression of Nucks in both proliferating and quiescent cells and its correlation with Bax levels and apoptosis strongly suggest that Nucks plays complex roles in cell homeostasis.
23065711 Through a combination of gene expression and copy number analysis, NUCKS1 was identified as a candidate gene involved in the distant metastasis of colorectal cancer.
20683486 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20069058 Overexpression of NUCKS can play significant role in breast cancer biology.
19915576 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19915575 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19664271 The results show overexpression of the NUCKS protein and RNA in a number of non malignant breast lesions and cancerous tissues. In particular, the NUCKS overexpression in ADH and DCIS indicates a significant role of this protein in neoplastic progression.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18491381 NUCKS appears to have the highest ratio of modified to unmodified residues of any protein so far described.
17604136 Two putative nuclear localization signals have been identified and characterized in NUCKS.

AA Sequence

MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKK      1 - 70
DDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMED     71 - 140
DDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDE    141 - 210
EPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED                                         211 - 243
//

Text Mined References (59)

PMID Year Title
26968889 2016 Identification of NUCKS1 as a putative oncogene and immunodiagnostic marker of hepatocellular carcinoma.
26323318 2015 NUCKS1 is a novel RAD51AP1 paralog important for homologous recombination and genome stability.
25434496 2015 Genetic variants at 1q32.1, 10q11.2 and 19q13.41 are associated with prostate-specific antigen for prostate cancer screening in two Korean population-based cohort studies.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25119009 2014 The comparison of nuclear ubiquitous casein and cyclin-dependent kinases substrate (NUCKS) with Ki67 proliferation marker expression in common skin tumors.
25116364 2014 NUCKS1, a novel Tat coactivator, plays a crucial role in HIV-1 replication by increasing Tat-mediated viral transcription on the HIV-1 LTR promoter.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24931609 2014 NUCKS is a positive transcriptional regulator of insulin signaling.
24842889 2014 Genome-wide mapping of IBD segments in an Ashkenazi PD cohort identifies associated haplotypes.
24819170 2014 NUCKS1 overexpression is a novel biomarker for recurrence-free survival in cervical squamous cell carcinoma.
24568505 2014 Effect of NUCKS-1 overexpression on cytokine profiling in obese women with breast cancer.
24284105 2013 Immunocytochemical studies on the nuclear ubiquitous casein and cyclin-dependent kinases substrate following 5-aminolevulinicacid-mediated photodynamic therapy on MCF-7 cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
24140890 2014 Dynamic expression of the vertebrate-specific protein Nucks during rodent embryonic development.
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
23269536 2013 Genome-wide association study identified novel genetic variant on SLC45A3 gene associated with serum levels prostate-specific antigen (PSA) in a Chinese population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23065711 2013 Identification of NUCKS1 as a colorectal cancer prognostic marker through integrated expression and copy number analysis.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20683486 2010 Genetic variability at the PARK16 locus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20069058 2009 Immunohistochemical and proteomic evaluation of nuclear ubiquitous casein and cyclin-dependent kinases substrate in invasive ductal carcinoma of the breast.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19915576 2009 Genome-wide association study identifies common variants at four loci as genetic risk factors for Parkinson's disease.
19915575 2009 Genome-wide association study reveals genetic risk underlying Parkinson's disease.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19664271 2009 NUCKS overexpression in breast cancer.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18491381 2008 Constitutive and dynamic phosphorylation and acetylation sites on NUCKS, a hypermodified nuclear protein, studied by quantitative proteomics.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17693683 2007 Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction.
17604136 2007 Identification and characterization of two putative nuclear localization signals (NLS) in the DNA-binding protein NUCKS.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15381070 2004 Characterisation of the NUCKS gene on human chromosome 1q32.1 and the presence of a homologous gene in different species.
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12413487 2002 A putative DNA-binding domain in the NUCKS protein.
12368243 2002 Identification and confirmation of a module of coexpressed genes.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
11298763 2001 Molecular cloning of a mammalian nuclear phosphoprotein NUCKS, which serves as a substrate for Cdk1 in vivo.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.