Property Summary

NCBI Gene PubMed Count 85
PubMed Score 111.04
PubTator Score 171.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
nephrosclerosis 1.095 2.6e-04
Waldenstrons macroglobulinemia 1.405 2.6e-02
malignant mesothelioma -1.400 3.8e-07
psoriasis -1.200 2.7e-03
osteosarcoma -1.886 6.2e-03
posterior fossa group B ependymoma 1.400 1.0e-08
glioblastoma 1.100 2.5e-03
Amyotrophic Lateral Sclerosis 1.408 1.2e-06
primary pancreatic ductal adenocarcinoma -2.238 7.1e-03
intraductal papillary-mucinous adenoma (... -1.500 6.8e-03
intraductal papillary-mucinous carcinoma... -1.900 8.3e-03
intraductal papillary-mucinous neoplasm ... -3.000 1.2e-03
lung cancer -1.800 8.7e-04
colon cancer -1.100 1.7e-02
active Crohn's disease 2.219 1.5e-03
pancreatic cancer -2.300 7.2e-03
diabetes mellitus -1.100 2.9e-02
group 3 medulloblastoma 1.300 3.0e-04
Pneumonia -1.400 9.7e-03
subependymal giant cell astrocytoma 2.254 4.5e-02
nasopharyngeal carcinoma -1.400 7.0e-05
progressive supranuclear palsy -1.300 9.9e-03
gastric carcinoma -1.500 3.4e-02
ulcerative colitis 1.900 8.2e-08
ovarian cancer 3.200 2.7e-06

Gene RIF (70)

PMID Text
26831553 Data indicate a positive correlation of nesfatin-1 and a negative correlation of orexin-A with body mass index.
26744860 nesfatin-1 might have an important role in regulation of food intake and pathogenesis of loss of appetite in children.
26624852 1012C>G polymorphism of NUCB2 is correlated with a reduced risk of developing MetS in a Chinese Han population.
26162003 Circulating NUCB2/nesfatin-1 levels correlated positively with perceived anxiety, whereas no association with body mass index or eating disorder symptoms was observed.
26143537 These results corroborate the suggestion of NUCB2/nesfatin-1 being relevantly involved in the regulation of mood and stress in a sex-specific way
25872767 This investigation indicates a marked association of serum and synovial fluid nesfatin-1 concentrations with osteoarthritis disease severity.
25869615 nesfatin-1 inhibits the growth of adrenocortical H295R cells and promotes apoptosis, potentially via the involvement of Bax, BCL-XL and BCL-2 genes as well as ERK1/2, p38 and JNK1/2 signalling cascades
25841171 This study shows an association of serum nesfatin-1 concentrations and the development and severity of peripheral arterial disease in type 2 diabetes mellitus patients.
25833360 Serum nesfatin-1 levels are significantly higher in girls with premature thelarche compared to prepubertal controls.
25581765 Plasma IL-6 and TNF-alpha did not significantly change after training, but nesfatin increased significantly only with high-intensity interval training compared with the control group.
25432328 Nesfatin-1 levels were significantly lower in metabolic syndrome (MS) group compared to non-MS group
25322808 Our results show that NUCB2 plays an important role in tumorigenesis and progression and is a potential molecular biomarker for the diagnosis and targeted therapy of ccRCC.
25068306 Serum nesfatin-1 levels were measured in patients with subclinical or overt hyperthyroidism to see whether nesfatin-1 is involved in the regulation of appetite and body weight in hyperthyroidism. No significant difference from normal controls was found.
24920281 Data suggest that plasma nesfatin-1/NUCB2 levels are up-regulated in pregnant women recently diagnosed with polycystic ovary syndrome (PCOS) as compared to healthy women; many of those with PCOS were also overweight and exhibited insulin resistance.
24891763 NUCB2/nesfatin-1 and visfatin are novel factors associated with systemic inflammation in COPD; visfatin may mediate impaired pulmonary diffusing capacity
24857385 Data indicate that patients with severe preeclampsia showed significantly decreased levels of serum nesfatin-1 compared with those with mild preeclampsia.
24825087 there was no significant increase in postprandial level of nesfatin-1. This suggests that oral glucose load in obese children may not be sufficient for nesfatin-1 response and that nesfatin-1 may not have an effect as short-term regulator of food intake.
24464950 study demonstrated cytoplasmic localization of NUCB2/nesfatin-1 peptide in both human and murine chondrocytes.
24422979 NUCB2 protein expression showed a strong association with the potencies of BCR and progression of PCa, and that may be applied as a novel biomarker.
24333832 Nesfatin-1 might have an important role in regulation of food intake and pathogenesis of insulin resistance in obese children and young adolescents.
24259949 Nesfatin-1 is present in articular tissues and may contribute to the physiopathologic changes in OA. Nesfatin-1, accompanied with hsCRP and IL-18, could have roles in the progression of knee osteoarthritis
24092574 we demonstrated that high NUCB2 mRNA expression correlated with poor overall survival in patients with prostate cancer
24048879 Role of NUCB2/Nesfatin-1 in the hypothalamic control of energy homeostasis.
23980879 Review highlights evidence of changes in circulating levels of NUCB2/nesfatin-1 in disease states, occurrence of NUCB2 polymorphisms and independence of leptin signalling known to be blunted under conditions of chronically increased body weight.
23958433 Kaplan-Meier survival analysis showed that patients with high NUCB2 expression have shorter biochemical recurrence (BCR)-free survival time compared to patients with low NUCB2 expression.
23955480 Data suggest that NUCB2 expression is widespread in including adipose tissue, pancreas, and digestive tract; NUCB2 appears to participate in regulation of energy homeostasis/appetite; genetic polymorphisms in NUCB2 may predispose to obesity. [REVIEW]
23806888 In acute myocardial infarction patients, plasma nesfatin-1 levels were negatively correlated with high-sensitivity C-reactive protein, neutrophil% or Gensini scores.
23796625 plasma NUCB2/nesfatin-1 levels were altered under conditions of perceived anxiety, stress and depression in obese women.
23768444 Circulating nesfatin-1 may modulate glucose homeostasis during diabetes remission in gastric bypass and sleeve gastrectomy, and participate in regulating body weight in sleeve gastrectomy
23765387 Increased nucleobindin-2 (NUCB2) transcriptional activity links the regulation of insulin sensitivity in Type 2 diabetes mellitus.
23764403 This study provides a novel regulatory signaling pathway of nesfatin-1-regulated ovarian epithelial carcinoma growth and may contribute to ovarian cancer prevention and therapy, especially in obese patients.
23739643 Nesfatin-1 levels were lower in children with untreated autoimmune thyroid diseases, however, the mechanism is also unknown.
23613885 pro-osteogenic activity of NUCB2(1-83)
23524986 A statistically significant correlation was found between the serum nesfatin-1 level and supraventricular tachycardia.
23515787 Ghrelin and NUCB2/nesfatin-1 are expressed in the same gastric cell and differentially correlated with body mass index in obese subjects.
23346951 Data suggest that serum nesfatin-1 are significantly lower in obese youth than in healthy control youth; no association was found with insulin resistance in obese subjects.
23306670 In advanced cystic fibrosis and low fat mass, nesfatin-1 plasma levels are significantly increased and inversely correlated with the fat mass.
23269222 Loss of fat mass may decrease serum nesfatin-1 level in lung cancer patients with weight loss.
23266808 The NUCB2 variant c.1012C>G (Q338E) is associated with childhood adiposity. The GG genotype may be protective against excessive weight gain.
23178145 nesfatin-1 levels are decreased in large for gestational age compared to appropriate for gestational age fetuses.
23155701 Nesfatin-1 is involved in the physiological regulation of intrauterine and postnatal growth and development in small for gestational ages infants.
23141462 we have identified the first rare genetic variants in the NUCB2 gene in obese individuals (frequency 0.2%), suggesting that NUCB2 might indeed be involved in the regulation of energy homeostasis and food intake.
22950627 Nesfatin-1 concentrations were reduced in non-alcoholic fatty liver disease.
22367584 Lower nesfatin-1 concentration may plays a very important role in the development of polycystic ovary syndrome
22334726 NUCB2 may operate directly at the testicular level to link energy homeostasis, puberty onset, and gonadal function
22270345 We have demonstrated that the Wa antigen is NEFA or nucleobindin-2, which binds specific tRNA species, and is distributed in specific human tissues.
22225987 the details of nesfatin-1 physiology ought to be clarified, and it may be considered suitable in the future, as a potential drug in the pharmacotherapy of obesity--{REVIEW}
22203468 Data suggest that maternal serum levels of nesfatin-1 (derived from NUCB2) are lower in patients with gestational diabetes compared with control pregnant women; however, the cord blood nesfatin-1 levels are similar.
22108805 Human islet NUCB2 mRNA was reduced in T2D subjects but upregulated after culture in glucolipotoxic conditions. Furthermore, a positive correlation between NUCB2 and glucagon and insulin gene expression, as well as insulin secretory capacity, was evident.
22036920 nesfatin-1 levels did not differ between hemodialysis patients and healthy subjects and negatively correlated with protein intake
22020667 Plasma nesfatin-1 concentrations were found to be elevated in subjects with both impaired glucose tolerance and newly diagnosed T2 diabetes mellitus.
21988594 High NUCB2 is associated with recurrence and metastasis in breast carcinoma.
21803054 This study demonistrated thatsex difference in NUCB2 dynamic expressions in the midbrain of drug-free depressed suicide victims.
21653697 structural basis for the properties of Calnuc and NUCB2 binding to Galpha subunits and its regulation by calcium ions.
21554911 Increased serum prolactin and nesfatin-1 concentrations, decreased ghrelin concentrations could be used as markers to identify patients that have suffered a recent epileptic seizure or other paroxysmal event (psychogenic).
21459029 polymorphisms in the NUCB2 gene could play an important role in the protection against the development of obesity in male subjects
21252251 Potential weight-reducing actions of nesfatin-1/NUCB-2 treatment.
20937336 nesfatin-1 levels may be regulated by nutrition status and response to starvation.
20813143 Apelins and nesfatin-1 concentrations were higher in mature milk than in colostrum (P<0.05). The concentration of apelins, ghrelins and nesfatin-1 in serum and milk in gestational diabetic lactating women was lower than in control samples
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20625762 lack of nesfatin-1 response to the exercise protocols may be partially due to the fasting condition
20427481 Data report that nesfatin-1 is a novel depot specific adipokine preferentially produced by sc tissue, with obesity- and food deprivation-regulated expression.
20032201 The release of NUCB2 from isolated islets was significantly elevated following glucose challenge.
20030931 nucb2 is the direct target gene of AML1 and AML1-ETO, the transcription regulation of AML1, AML1-ETO on nucb2 is carried out via repressing its promoter activity.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19351608 NUCB2 may be implicated in gastric secretion by establishing an agonist-releasable Ca2+ store in ER or Golgi apparatus, signalling via heterotrimeric Galpha proteins and/or mediating the exocytosis of the secretory granules.
19262995 low ghrelin and especially the dramatically elevated nesfatin-1 levels might contribute to the pathophyisology of epilepsy[Nesfatin-1]
18154733 results suggest that the functions of nucleobindins could be modulated by caspase-mediated cleavage in apoptosis
16407280 NUCB2-ARTS-1 complexes play an important role in mediating tumor necrosis factor receptor 1 release to the extracellular compartment.
16407280 Calcium-dependent ARTS-1-nucleobindin 2 complexes associate with TNFR1 prior to the commitment of TNFR1 to pathways that result in the constitutive release of TNFR1 exosome-like vesicles or the inducible proteolytic cleavage of TNFR1 ectodomains.

AA Sequence

MRWRTILLQYCFLLITCLLTALEAVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKH      1 - 70
FREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDELKRQEVGRLRMLIKAKLDSLQDIGMDHQALLKQFD     71 - 140
HLNHLNPDKFESTDLDMLIKAATSDLEHYDKTRHEEFKKYEMMKEHERREYLKTLNEEKRKEEESKFEEM    141 - 210
KKKHENHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNSDGFLDEQELEALFTKELEKVYDP    211 - 280
KNEEDDMVEMEEERLRMREHVMSEVDTNKDRLVTLEEFLKATEKKEFLEPDSWETLDQQQFFTEEELKEY    281 - 350
ENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPHI    351 - 420
//

Text Mined References (91)

PMID Year Title
26831553 2015 Correlation of Brain Neuropeptide (Nesfatin-1 and Orexin-A) Concentrations with Anthropometric and Biochemical Parameters in Malnourished Children.
26744860 2015 Role of circulating nesfatin-1 in the underweight children with poor appetite.
26624852 2016 Association of the Polymorphism in Nucleobindin 2 Gene and the Risk of Metabolic Syndrome.
26162003 2015 NUCB2/nesfatin-1 Is Associated with Elevated Levels of Anxiety in Anorexia Nervosa.
26143537 2015 Sex-specific regulation of NUCB2/nesfatin-1: Differential implication in anxiety in obese men and women.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25872767 2015 Serum and synovial fluid nesfatin-1 concentration is associated with radiographic severity of knee osteoarthritis.
25869615 2015 Nesfatin-1 inhibits proliferation and enhances apoptosis of human adrenocortical H295R cells.
25841171 2015 Serum nesfatin-1 is reduced in type 2 diabetes mellitus patients with peripheral arterial disease.
25833360 2015 Serum nesfatin-1 and leptin levels in non-obese girls with premature thelarche.
25581765 2015 The effects of short-term high-intensity interval training vs. moderate-intensity continuous training on plasma levels of nesfatin-1 and inflammatory markers.
25432328 2015 The evaluation of Nesfatin-1 levels in patients with OSAS associated with metabolic syndrome.
25322808 2015 Nucleobindin 2 expression is an independent prognostic factor for clear cell renal cell carcinoma.
25068306 2014 Serum nesfatin-1 levels in overt and subclinical hyperthyroidism.
24920281 2014 Plasma nesfatin-1 levels are increased in patients with polycystic ovary syndrome.
24891763 2014 Adipokines NUCB2/nesfatin-1 and visfatin as novel inflammatory factors in chronic obstructive pulmonary disease.
24857385 2014 Decreased levels of serum nesfatin-1 in patients with preeclampsia.
24825087 2014 Fasting and postprandial levels of a novel anorexigenic peptide nesfatin in childhood obesity.
24464950 2014 NUCB2/nesfatin-1: a new adipokine expressed in human and murine chondrocytes with pro-inflammatory properties, an in vitro study.
24422979 2013 Prognostication of prostate cancer based on NUCB2 protein assessment: NUCB2 in prostate cancer.
24333832 2014 Nesfatin-1 in childhood and adolescent obesity and its association with food intake, body composition and insulin resistance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24259949 2013 Increased serum levels and chondrocyte expression of nesfatin-1 in patients with osteoarthritis and its relation with BMI, hsCRP, and IL-18.
24092574 2014 High expression of nucleobindin 2 mRNA: an independent prognostic factor for overall survival of patients with prostate cancer.
24048879 2013 Role of NUCB2/Nesfatin-1 in the hypothalamic control of energy homeostasis.
23980879 2013 The role of nesfatin-1 in the regulation of food intake and body weight: recent developments and future endeavors.
23958433 2013 Clinical significance of NUCB2 mRNA expression in prostate cancer.
23955480 2013 Recent progress in research on the distribution and function of NUCB2/nesfatin-1 in peripheral tissues.
23806888 2013 Decreased plasma nesfatin-1 levels in patients with acute myocardial infarction.
23796625 2013 NUCB2/nesfatin-1 is associated with elevated scores of anxiety in female obese patients.
23768444 2013 Differential influences of gastric bypass and sleeve gastrectomy on plasma nesfatin-1 and obestatin levels in patients with type 2 diabetes mellitus.
23765387 2013 Increased nucleobindin-2 (NUCB2) transcriptional activity links the regulation of insulin sensitivity in Type 2 diabetes mellitus.
23764403 2013 Nesfatin-1 inhibits ovarian epithelial carcinoma cell proliferation in vitro.
23739643 2013 [Analysis of serum levels of nesfatin-1 in children and adolescents with autoimmune thyroid diseases].
23613885 2013 The novel pro-osteogenic activity of NUCB2(1-83.).
23524986 2013 The effect of nesfatin-1 levels on paroxysmal supraventricular tachycardia.
23515787 2013 Ghrelin and NUCB2/nesfatin-1 are expressed in the same gastric cell and differentially correlated with body mass index in obese subjects.
23346951 2013 The relation of serum nesfatin-1 level with metabolic and clinical parameters in obese and healthy children.
23306670 2013 Association of nesfatin-1 and fat mass in cystic fibrosis.
23269222 2013 Nesfatin-1 in advanced lung cancer patients with weight loss.
23266808 2013 The association of a nucleobindin 2 gene (NUCB2) variant with childhood adiposity.
23178145 2013 Cord blood nesfatin-1 in large for gestational age pregnancies.
23155701 2012 Nesfatin-1 in newborns: relationship with endocrine and metabolic and anthropometric measures.
23141462 2012 Identification of mutations in the NUCB2/nesfatin gene in children with severe obesity.
22950627 2012 A novel appetite peptide, nesfatin-1 in patients with non-alcoholic fatty liver disease.
22367584 2012 Nesfatin-1 and other hormone alterations in polycystic ovary syndrome.
22334726 2012 Cellular distribution, regulated expression, and functional role of the anorexigenic peptide, NUCB2/nesfatin-1, in the testis.
22270345 2012 NEFA/nucleobindin-2 is a target autoantigen of the anti-Wa antibody and is associated with transfer RNA.
22225987 2012 Nesfatin-1, a unique regulatory neuropeptide of the brain.
22203468 2012 Cord blood nesfatin-1 and apelin-36 levels in gestational diabetes mellitus.
22108805 2011 Nesfatin-1 stimulates glucagon and insulin secretion and beta cell NUCB2 is reduced in human type 2 diabetic subjects.
22036920 2012 The newly identified anorexigenic adipokine nesfatin-1 in hemodialysis patients: Are there associations with food intake, body composition and inflammation?
22020667 2012 Increased plasma levels of nesfatin-1 in patients with newly diagnosed type 2 diabetes mellitus.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21988594 2012 Nucleobindin 2 in human breast carcinoma as a potent prognostic factor.
21803054 2012 Sex-specific differences in the dynamics of cocaine- and amphetamine-regulated transcript and nesfatin-1 expressions in the midbrain of depressed suicide victims vs. controls.
21653697 2011 G Protein binding sites on Calnuc (nucleobindin 1) and NUCB2 (nucleobindin 2) define a new class of G(alpha)i-regulatory motifs.
21554911 2011 Time-dependent changes in the serum levels of prolactin, nesfatin-1 and ghrelin as a marker of epileptic attacks young male patients.
21459029 2011 Association between polymorphisms of the Nesfatin gene, NUCB2, and obesity in men.
21269460 2011 Initial characterization of the human central proteome.
21252251 2011 Decreased cerebrospinal fluid/plasma ratio of the novel satiety molecule, nesfatin-1/NUCB-2, in obese humans: evidence of nesfatin-1/NUCB-2 resistance and implications for obesity treatment.
20937336 2011 Plasma nesfatin-1 concentrations in restricting-type anorexia nervosa.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20813143 2010 The presence of the peptides apelin, ghrelin and nesfatin-1 in the human breast milk, and the lowering of their levels in patients with gestational diabetes mellitus.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20625762 2010 Plasma nesfatin-1 and glucoregulatory hormone responses to two different anaerobic exercise sessions.
20427483 2010 Troglitazone, a ligand of peroxisome proliferator-activated receptor-{gamma}, stabilizes NUCB2 (Nesfatin) mRNA by activating the ERK1/2 pathway: isolation and characterization of the human NUCB2 gene.
20427481 2010 Identification of nesfatin-1 in human and murine adipose tissue: a novel depot-specific adipokine with increased levels in obesity.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20032201 2010 Nucleobindin-2/nesfatin in the endocrine pancreas: distribution and relationship to glycaemic state.
20030931 2009 [Influence of AML1 and AML1-ETO on transcriptional regulation of nucb2 gene].
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19351608 Molecular characterisation and expression analysis of SEREX-defined antigen NUCB2 in gastric epithelium, gastritis and gastric cancer.
19262995 2009 Nesfatin-1 and ghrelin levels in serum and saliva of epileptic patients: hormonal changes can have a major effect on seizure disorders.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18154733 2008 Modulation of nucleobindin-1 and nucleobindin-2 by caspases.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16407280 2006 Extracellular TNFR1 release requires the calcium-dependent formation of a nucleobindin 2-ARTS-1 complex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15308636 2004 Proteomics of endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membranes from brefeldin A-treated HepG2 cells identifies ERGIC-32, a new cycling protein that interacts with human Erv46.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12087473 2002 Serological identification and expression analysis of gastric cancer-associated genes.
11749975 2001 Golgi retention of human protein NEFA is mediated by its N-terminal Leu/Ile-rich region.
10915798 2000 The postmitotic growth suppressor necdin interacts with a calcium-binding protein (NEFA) in neuronal cytoplasm.
10381334 1999 Heterologous overexpression of human NEFA and studies on the two EF-hand calcium-binding sites.
9639681 1998 Assembly of a high-resolution map of the Acadian Usher syndrome region and localization of the nuclear EF-hand acidic gene.
7811391 1994 Human protein NEFA, a novel DNA binding/EF-hand/leucine zipper protein. Molecular cloning and sequence analysis of the cDNA, isolation and characterization of the protein.