Property Summary

Ligand Count 2
NCBI Gene PubMed Count 32
PubMed Score 546.95
PubTator Score 129.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.200 1.8e-03
atypical teratoid / rhabdoid tumor 1.100 5.3e-04
COPD -1.300 1.1e-02
dermatomyositis -1.600 8.7e-04
diabetes mellitus -1.200 2.2e-03
ependymoma 1.100 3.9e-03
glioblastoma 1.200 2.7e-04
group 3 medulloblastoma -1.300 8.0e-03
pancreatic ductal adenocarcinoma liver m... -1.526 1.6e-03
psoriasis -1.800 4.6e-05
Rheumatoid arthritis -1.500 4.8e-02

Gene RIF (12)

AA Sequence

MPPSGPRGTLLLLPLLLLLLLRAVLAVPLERGAPNKEETPATESPDTGLYYHRYLQEVIDVLETDGHFRE      1 - 70
KLQAANAEDIKSGKLSRELDFVSHHVRTKLDELKRQEVSRLRMLLKAKMDAEQDPNVQVDHLNLLKQFEH     71 - 140
LDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGEEQRKEAERKLEEQQ    141 - 210
RRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPK    211 - 280
NEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGEGWETVEMHPAYTEEELRRF    281 - 350
EEELAAREAELNAKAQRLSQETEALGRSQGRLEAQKRELQQAVLHMEQRKQQQQQQQGHKAPAAHPEGQL    351 - 420
KFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL                                 421 - 461
//

Text Mined References (37)

PMID Year Title