Property Summary

NCBI Gene PubMed Count 12
PubMed Score 19.96
PubTator Score 17.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 5.2e-05
osteosarcoma 7950 8.5e-04
primitive neuroectodermal tumor 3035 1.5e-03
group 3 medulloblastoma 4104 1.7e-03
glioblastoma 5792 3.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Syndactyly 88 3.249 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.200 3.8e-03
group 3 medulloblastoma 1.100 1.7e-03
osteosarcoma -1.238 8.5e-04
ovarian cancer 1.100 5.2e-05
primitive neuroectodermal tumor 1.100 1.5e-03

Gene RIF (4)

AA Sequence

MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKST      1 - 70
FSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDD     71 - 140
AVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVR    141 - 210
KEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKG    211 - 280
QSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS                                  281 - 320
//

Text Mined References (17)

PMID Year Title