Property Summary

NCBI Gene PubMed Count 35
PubMed Score 33.48
PubTator Score 31.99

Knowledge Summary

Patent (3,399)

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 1.200 1.2e-06
astrocytic glioma -2.500 1.7e-03
ependymoma -1.800 2.2e-02
oligodendroglioma -2.000 1.6e-02
glioblastoma -2.300 4.7e-05
medulloblastoma -2.100 9.7e-07
cystic fibrosis -2.100 6.3e-07
atypical teratoid / rhabdoid tumor -1.900 2.9e-04
medulloblastoma, large-cell -2.800 6.2e-05
primitive neuroectodermal tumor -1.500 1.1e-02
primary pancreatic ductal adenocarcinoma 1.347 7.4e-03
lung cancer -1.500 5.8e-04
pancreatic cancer 1.400 6.0e-03
interstitial cystitis 1.200 3.7e-04
adult high grade glioma -2.100 5.7e-05
pilocytic astrocytoma -1.600 1.9e-05
subependymal giant cell astrocytoma -2.024 4.5e-02
invasive ductal carcinoma -1.800 2.2e-03
nasopharyngeal carcinoma 1.100 1.1e-04
ductal carcinoma in situ -1.200 1.5e-02
ovarian cancer 2.100 2.2e-03

Protein-protein Interaction (3)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (26)

PMID Text
26255969 MiR-145 functions as a tumor suppressor targeting NUAK1 in human intrahepatic cholangiocarcinoma.
26151663 ARK5 was upregulated in ovarian cancer tissues, promoted epithelialmesenchymal transition and inhibited miR-1181 expression in ovarian cancer cells
25412236 Results indicate that NUAK1 is excessively expressed in NSCLC and plays important roles in NSCLC invasion.
25242509 Data indicate that miR-96 suppresses the expression of (nua) kinase family 1 (NUAK1) by targeting its 3' untranslated region (3' UTR).
24943992 Overexpression of NUAK1 is associated with disease-free survival and overall survival in patients with gastric cancer.
24785407 Expression of NUAK1 is controlled by cyclin-dependent kinase, PLK1, and the SCFbetaTrCP (Skp, Cullin and F-boxbetaTrCP) E3 ubiquitin ligase complex.
23934065 We demonstrate that miR-211 contributes to melanoma adhesion by directly targeting a gene, NUAK1.
23516026 Overexpression of ARK5 is associated with hepatocellular carcinoma.
23215946 High NUAK1 expression correlates with poor prognosis and involved in human nonsmall cell lung cancer cells migration and invasion.
23063350 ARK5 can promote glioma cell invasion by regulating cytoskeleton rearrangement and matrix metalloproteinase activation.
22460906 in human and murine cell lines, oncogenic levels of MYC establish a dependence on AMPK-related kinase 5 for maintaining metabolic homeostasis and for cell survival; ARK5 is an upstream regulator of AMPK and limits protein synthesis via inhibition of the mammalian target of rapamycin 1 (mTORC1) signalling pathway
22105900 ARK5 enhanced the invasive and metastatic potential of MDA-MB-231 cells under regulation by Akt.
21750233 NUAK1 and PPP1CC are identified as positional candidate loci for skeletal muscle strength phenotypes.
21317932 A novel role for NUAK1 in LKB1-related signaling pathways; NUAK1 can regulate cell proliferation and exert tumor suppression through direct interaction with p53.
20978832 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20602751 Observational study of gene-disease association. (HuGE Navigator)
20354225 the LKB1-NUAK pathway has roles in controlling myosin phosphatase complexes and cell adhesion
19927127 Cells that constitutively express NUAK1 suffer gross aneuploidies and show diminished expression of the genomic stability regulator LATS1, whereas depletion of NUAK1 with shRNA exerts opposite effects.
18254724 NUAK1 and MARK4 are substrates of USP9X
16488889 NDR2 is an upstream kinase of ARK5 that plays an essential role in tumor progression through ARK5
16044163 ARK5 is a transcriptional target of the Large-MAF family through MARE sequence and that ARK5 may in part mediate the aggressive phenotype associated with c-MAF- and MAFB-expressing myelomas
15354411 overexpression of ARK5 is associated with tumor invasion and metastasis
15273717 ARK5 negatively regulates procaspase-6 by phosphorylation at Ser257, leading to resistance to the FasL/Fas system.
15060171 Results report that a novel AMPK catalytic subunit family member, ARK5, plays a key role in tumor malignancy downstream of Akt.
13679856 ARK5 suppresses the apoptosis induced by nutrient starvation and death receptors via inhibition of caspase 8 activation.
12409306 Data suggest that a novel AMPK family member, ARK5, is the tumor cell survival factor activated by Akt and acts as an ATM kinase under the conditions of nutrient starvation.

AA Sequence

MEGAAAPVAGDRPDLGLGAPGSPREAVAGATAALEPRKPHGVKRHHHKHNLKHRYELQETLGKGTYGKVK      1 - 70
RATERFSGRVVAIKSIRKDKIKDEQDMVHIRREIEIMSSLNHPHIISIYEVFENKDKIVIIMEYASKGEL     71 - 140
YDYISERRRLSERETRHFFRQIVSAVHYCHKNGVVHRDLKLENILLDDNCNIKIADFGLSNLYQKDKFLQ    141 - 210
TFCGSPLYASPEIVNGRPYRGPEVDSWALGVLLYTLVYGTMPFDGFDHKNLIRQISSGEYREPTQPSDAR    211 - 280
GLIRWMLMVNPDRRATIEDIANHWWVNWGYKSSVCDCDALHDSESPLLARIIDWHHRSTGLQADTEAKMK    281 - 350
GLAKPTTSEVMLERQRSLKKSKKENDFAQSGQDAVPESPSKLSSKRPKGILKKRSNSEHRSHSTGFIEGV    351 - 420
VGPALPSTFKMEQDLCRTGVLLPSSPEAEVPGKLSPKQSATMPKKGILKKTQQRESGYYSSPERSESSEL    421 - 490
LDSNDVMGSSIPSPSPPDPARVTSHSLSCRRKGILKHSSKYSAGTMDPALVSPEMPTLESLSEPGVPAEG    491 - 560
LSRSYSRPSSVISDDSVLSSDSFDLLDLQENRPARQRIRSCVSAENFLQIQDFEGLQNRPRPQYLKRYRN    561 - 630
RLADSSFSLLTDMDDVTQVYKQALEICSKLN                                           631 - 661
//

Text Mined References (41)

PMID Year Title
26255969 2015 MiR-145 functions as a tumor suppressor targeting NUAK1 in human intrahepatic cholangiocarcinoma.
26151663 2015 Activation of ARK5/miR-1181/HOXA10 axis promotes epithelial-mesenchymal transition in ovarian cancer.
25412236 2014 MiR-204 inhibits human NSCLC metastasis through suppression of NUAK1.
25329316 2014 A mouse model uncovers LKB1 as an UVB-induced DNA damage sensor mediating CDKN1A (p21WAF1/CIP1) degradation.
25242509 2014 miR?96 functions as a tumor suppressor gene by targeting NUAK1 in pancreatic cancer.
24943992 2014 Overexpression of NUAK1 is associated with disease-free survival and overall survival in patients with gastric cancer.
24785407 2014 Interplay between Polo kinase, LKB1-activated NUAK1 kinase, PP1?MYPT1 phosphatase complex and the SCF?TrCP E3 ubiquitin ligase.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
23934065 2014 Transcription factor/microRNA axis blocks melanoma invasion program by miR-211 targeting NUAK1.
23516026 2013 Overexpression of ARK5 is associated with poor prognosis in hepatocellular carcinoma.
23419831 2014 APOE and BCHE as modulators of cerebral amyloid deposition: a florbetapir PET genome-wide association study.
23215946 2013 High NUAK1 expression correlates with poor prognosis and involved in NSCLC cells migration and invasion.
23063350 2013 ARK5 promotes glioma cell invasion, and its elevated expression is correlated with poor clinical outcome.
22460906 2012 Deregulated MYC expression induces dependence upon AMPK-related kinase 5.
22105900 2012 ARK5 is associated with the invasive and metastatic potential of human breast cancer cells.
21750233 2011 Identification and prioritization of NUAK1 and PPP1CC as positional candidate loci for skeletal muscle strength phenotypes.
21317932 2011 A new role of NUAK1: directly phosphorylating p53 and regulating cell proliferation.
20978832 2011 Gene-environment interaction in the etiology of mathematical ability using SNP sets.
20602751 2010 Generalist genes analysis of DNA markers associated with mathematical ability and disability reveals shared influence across ages and abilities.
20354225 2010 New roles for the LKB1-NUAK pathway in controlling myosin phosphatase complexes and cell adhesion.
19927127 2010 Regulation of ploidy and senescence by the AMPK-related kinase NUAK1.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18254724 2008 Control of AMPK-related kinases by USP9X and atypical Lys(29)/Lys(33)-linked polyubiquitin chains.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16541075 2006 The finished DNA sequence of human chromosome 12.
16488889 2006 NDR2 acts as the upstream kinase of ARK5 during insulin-like growth factor-1 signaling.
16424013 2006 Overexpression of c-Maf contributes to T-cell lymphoma in both mice and human.
16306228 2005 14-3-3 cooperates with LKB1 to regulate the activity and localization of QSK and SIK.
16044163 2005 ARK5 is transcriptionally regulated by the Large-MAF family and mediates IGF-1-induced cell invasion in multiple myeloma: ARK5 as a new molecular determinant of malignant multiple myeloma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15354411 2004 Strong association of ARK5 with tumor invasion and metastasis.
15273717 2004 Regulation of caspase-6 and FLIP by the AMPK family member ARK5.
15060171 2004 ARK5 is a tumor invasion-associated factor downstream of Akt signaling.
14982852 2004 ARK5 expression in colorectal cancer and its implications for tumor progression.
14976552 2004 LKB1 is a master kinase that activates 13 kinases of the AMPK subfamily, including MARK/PAR-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
13679856 2003 ARK5 suppresses the cell death induced by nutrient starvation and death receptors via inhibition of caspase 8 activation, but not by chemotherapeutic agents or UV irradiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12409306 2003 Identification of a novel protein kinase mediating Akt survival signaling to the ATM protein.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.