Property Summary

Ligand Count 7
NCBI Gene PubMed Count 39
PubMed Score 38.71
PubTator Score 31.99

Knowledge Summary

Patent (3,399)

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -2.100 5.7e-05
astrocytic glioma -2.500 1.7e-03
Astrocytoma, Pilocytic -1.600 1.7e-05
atypical teratoid / rhabdoid tumor -1.900 2.9e-04
cystic fibrosis -2.100 6.3e-07
ductal carcinoma in situ -1.200 1.5e-02
ependymoma -1.800 2.2e-02
glioblastoma -1.800 6.9e-07
group 4 medulloblastoma -1.300 1.3e-03
interstitial cystitis 1.200 3.7e-04
invasive ductal carcinoma 1.063 1.0e-02
lung cancer -1.500 5.8e-04
malignant mesothelioma 1.200 1.2e-06
medulloblastoma, large-cell -2.800 6.2e-05
nasopharyngeal carcinoma 1.100 1.1e-04
oligodendroglioma -2.000 1.6e-02
ovarian cancer 2.100 2.2e-03
pancreatic cancer 1.100 1.7e-03
primary pancreatic ductal adenocarcinoma 1.347 7.4e-03
primitive neuroectodermal tumor -1.500 1.1e-02
subependymal giant cell astrocytoma -2.024 4.5e-02

Protein-protein Interaction (3)

Gene RIF (30)

AA Sequence

MEGAAAPVAGDRPDLGLGAPGSPREAVAGATAALEPRKPHGVKRHHHKHNLKHRYELQETLGKGTYGKVK      1 - 70
RATERFSGRVVAIKSIRKDKIKDEQDMVHIRREIEIMSSLNHPHIISIYEVFENKDKIVIIMEYASKGEL     71 - 140
YDYISERRRLSERETRHFFRQIVSAVHYCHKNGVVHRDLKLENILLDDNCNIKIADFGLSNLYQKDKFLQ    141 - 210
TFCGSPLYASPEIVNGRPYRGPEVDSWALGVLLYTLVYGTMPFDGFDHKNLIRQISSGEYREPTQPSDAR    211 - 280
GLIRWMLMVNPDRRATIEDIANHWWVNWGYKSSVCDCDALHDSESPLLARIIDWHHRSTGLQADTEAKMK    281 - 350
GLAKPTTSEVMLERQRSLKKSKKENDFAQSGQDAVPESPSKLSSKRPKGILKKRSNSEHRSHSTGFIEGV    351 - 420
VGPALPSTFKMEQDLCRTGVLLPSSPEAEVPGKLSPKQSATMPKKGILKKTQQRESGYYSSPERSESSEL    421 - 490
LDSNDVMGSSIPSPSPPDPARVTSHSLSCRRKGILKHSSKYSAGTMDPALVSPEMPTLESLSEPGVPAEG    491 - 560
LSRSYSRPSSVISDDSVLSSDSFDLLDLQENRPARQRIRSCVSAENFLQIQDFEGLQNRPRPQYLKRYRN    561 - 630
RLADSSFSLLTDMDDVTQVYKQALEICSKLN                                           631 - 661
//

Text Mined References (45)

PMID Year Title