Property Summary

NCBI Gene PubMed Count 21
PubMed Score 27.25
PubTator Score 20.92

Knowledge Summary

Patent (2,938)

Expression

  Differential Expression (10)

Disease log2 FC p
posterior fossa group A ependymoma -2.200 3.6e-10
glioblastoma -2.500 1.1e-04
group 3 medulloblastoma -3.500 1.5e-06
atypical teratoid/rhabdoid tumor -3.000 3.4e-13
medulloblastoma, large-cell -2.700 5.4e-05
primitive neuroectodermal tumor -2.900 6.4e-06
pediatric high grade glioma -1.900 4.2e-04
pilocytic astrocytoma -2.800 7.7e-10
subependymal giant cell astrocytoma -1.741 1.6e-02
Down syndrome 1.300 5.4e-04

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
588495 confirmatory 13 / 0 / 109 SAR analysis of small molecule NTR1 agonists in a image based NTR2 selectivity assay
602334 confirmatory 20 / 0 / 67 SAR analysis of small molecule NTR1 agonists in a image based NTR2 selectivity assay set 2

Gene RIF (10)

PMID Text
26298774 high expression of NTSR1 is found in clinical NETs and promoter methylation is an important mechanism controlling the differential expression of NTSR1 and silencing of NTSR2 in NET cells
23109725 NTSR2 was overexpressed, NTSR1 decreased, and neurotensin was not expressed in B cell leukemia patient's B-cells, as compared with healthy B cells.
20468071 Observational study of gene-disease association. (HuGE Navigator)
20048080 NTR2 and NTR3 were upregulated in prostate cancer cells with luminal phenotype (cytokeratin 18+)
19968961 this study proposes a novel function of NTR2 in the regulation of NTR1 activity.
19874574 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18624930 NTR1 and NTR2 mRNA were not detected in either pituitary adenomas or normal tissue.
15383539 ghrelin receptor, neurotensin receptor 2 and GPR39 display an unusually high degree of constitutive activity, determined by an aromatic cluster on the inner face of the extracellular ends of TMs VI and VII
11801734 Recycling ability depends on a single tyrosine residue

AA Sequence

METSSPRPPRPSSNPGLSLDARLGVDTRLWAKVLFTALYALIWALGAAGNALSAHVVLKARAGRAGRLRH      1 - 70
HVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAYATVLSVAGLSAERCLAVCQP     71 - 140
LRARSLLTPRRTRWLVALSWAASLGLALPMAVIMGQKHELETADGEPEPASRVCTVLVSRTALQVFIQVN    141 - 210
VLVSFVLPLALTAFLNGVTVSHLLALCSQVPSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVSL    211 - 280
VRHKDVRRIRSLQRSVQVLRAIVVMYVICWLPYHARRLMYCYVPDDAWTDPLYNFYHYFYMVTNTLFYVS    281 - 350
SAVTPLLYNAVSSSFRKLFLEAVSSLCGEHHPMKRLPPKPQSPTLMDTASGFGDPPETRT              351 - 410
//

Text Mined References (22)

PMID Year Title
26298774 2015 Differential expression and tumorigenic function of neurotensin receptor 1 in neuroendocrine tumor cells.
23109725 2012 Differential expression of neurotensin and specific receptors, NTSR1 and NTSR2, in normal and malignant human B lymphocytes.
20468071 2010 Evidence for genes on chromosome 2 contributing to alcohol dependence with conduct disorder and suicide attempts.
20048080 2010 Altered expression of neurotensin receptors is associated with the differentiation state of prostate cancer.
19968961 2010 Intermolecular cross-talk between NTR1 and NTR2 neurotensin receptor promotes intracellular sequestration and functional inhibition of NTR1 receptors.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18624930 2008 Expression of neurotensin and its receptors in pituitary adenomas.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383539 2004 Common structural basis for constitutive activity of the ghrelin receptor family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12150975 2002 Neurotensin counteracts apoptosis in breast cancer cells.
12065070 2002 Neurotensin causes tyrosine phosphorylation of focal adhesion kinase in lung cancer cells.
12036977 2002 Expression of neurotensin receptors in human corneal keratocytes.
11801734 2002 Recycling ability of the mouse and the human neurotensin type 2 receptors depends on a single tyrosine residue.
11564178 2001 Functional characterization of neurotensin receptors in human cutaneous T cell lymphoma malignant lymphocytes.
10390649 1999 Neurotensin and neurotensin receptors.
9851594 1998 Neurotensin is an antagonist of the human neurotensin NT2 receptor expressed in Chinese hamster ovary cells.
8795617 1996 Structure, functional expression, and cerebral localization of the levocabastine-sensitive neurotensin/neuromedin N receptor from mouse brain.
8647296 1996 Molecular cloning of a levocabastine-sensitive neurotensin binding site.