Property Summary

Ligand Count 30
NCBI Gene PubMed Count 21
PubMed Score 28.10
PubTator Score 20.92

Knowledge Summary

Patent (2,938)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.900 1.6e-04
Astrocytoma, Pilocytic -2.800 5.4e-10
atypical teratoid / rhabdoid tumor -2.900 2.7e-10
Down syndrome 1.300 5.4e-04
ependymoma -2.100 2.3e-02
glioblastoma -2.000 1.2e-05
group 3 medulloblastoma -3.500 1.5e-06
medulloblastoma, large-cell -2.700 5.4e-05
primitive neuroectodermal tumor -2.900 6.4e-06
subependymal giant cell astrocytoma -1.741 1.6e-02

Gene RIF (10)

AA Sequence

METSSPRPPRPSSNPGLSLDARLGVDTRLWAKVLFTALYALIWALGAAGNALSAHVVLKARAGRAGRLRH      1 - 70
HVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAYATVLSVAGLSAERCLAVCQP     71 - 140
LRARSLLTPRRTRWLVALSWAASLGLALPMAVIMGQKHELETADGEPEPASRVCTVLVSRTALQVFIQVN    141 - 210
VLVSFVLPLALTAFLNGVTVSHLLALCSQVPSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVSL    211 - 280
VRHKDVRRIRSLQRSVQVLRAIVVMYVICWLPYHARRLMYCYVPDDAWTDPLYNFYHYFYMVTNTLFYVS    281 - 350
SAVTPLLYNAVSSSFRKLFLEAVSSLCGEHHPMKRLPPKPQSPTLMDTASGFGDPPETRT              351 - 410
//

Text Mined References (22)

PMID Year Title