Property Summary

Ligand Count 26
NCBI Gene PubMed Count 138
PubMed Score 371.68
PubTator Score 230.25

Knowledge Summary

Patent (38,124)

Expression

  Differential Expression (20)

Disease log2 FC p
lung cancer -1.100 9.0e-03
adult high grade glioma -2.700 1.6e-06
Alzheimer's disease 1.200 3.9e-02
atypical teratoid / rhabdoid tumor -3.600 1.9e-08
Breast cancer -1.700 1.6e-08
breast carcinoma -1.200 1.2e-04
colon cancer -1.500 2.4e-04
ependymoma -2.400 1.8e-06
glioblastoma -1.900 2.3e-04
interstitial cystitis -1.200 2.8e-03
invasive ductal carcinoma -1.200 4.1e-03
medulloblastoma, large-cell -4.000 4.7e-08
oligodendroglioma 1.200 2.1e-03
osteosarcoma 1.244 6.6e-04
ovarian cancer -2.200 8.3e-05
Pick disease 1.300 7.8e-04
pituitary cancer -1.100 3.8e-02
progressive supranuclear palsy 1.300 4.4e-02
psoriasis -1.100 4.1e-29
sonic hedgehog group medulloblastoma 1.400 1.0e-03

Gene RIF (105)

AA Sequence

MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNAS      1 - 70
INITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLT     71 - 140
TLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEAKLNSQNLYCINADGSQLPLFRMNISQCDLP    141 - 210
EISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGF    211 - 280
TLTCIAENVVGMSNASVALTVYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHV    281 - 350
EYYQEGEISEGCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPIT    351 - 420
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASPLHHINHGITT    421 - 490
PSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVLKRELGEGAFGKVFLAECYNL    491 - 560
SPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLR    561 - 630
AHGPDAMILVDGQPRQAKGELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGM    631 - 700
SRDVYSTDYYRLFNPSGNDFCIWCEVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQP    701 - 770
WFQLSNTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG     771 - 839
//

Text Mined References (142)

PMID Year Title