Property Summary

Ligand Count 85
NCBI Gene PubMed Count 284
PubMed Score 1170.25
PubTator Score 600.00

Knowledge Summary

Patent (64,967)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Liver cancer 604 0.0 0.5

Expression

  Differential Expression (32)

Disease log2 FC p
lung cancer -1.200 1.7e-02
adult high grade glioma -1.900 2.4e-03
astrocytic glioma 2.000 3.0e-02
Astrocytoma, Pilocytic -1.600 2.9e-04
Atopic dermatitis -1.200 2.6e-03
atypical teratoid / rhabdoid tumor -1.300 4.9e-05
autosomal dominant Emery-Dreifuss muscul... 1.257 4.2e-02
Breast cancer -4.500 1.3e-25
breast carcinoma -1.400 1.6e-03
Down syndrome 1.700 8.7e-04
Duchenne muscular dystrophy 1.643 1.2e-05
ductal carcinoma in situ -1.900 2.0e-04
ependymoma -1.100 3.3e-02
esophageal adenocarcinoma -1.100 2.8e-02
glioblastoma -2.500 2.7e-06
group 3 medulloblastoma -1.900 4.9e-03
intraductal papillary-mucinous adenoma (... -1.900 8.7e-05
intraductal papillary-mucinous carcinoma... -2.000 8.0e-05
intraductal papillary-mucinous neoplasm ... -1.100 4.4e-02
invasive ductal carcinoma -1.814 9.6e-04
medulloblastoma, large-cell -1.300 4.5e-03
nasopharyngeal carcinoma 1.400 1.5e-02
non-small cell lung cancer 1.156 1.8e-04
oligodendroglioma 1.700 1.1e-02
pancreatic cancer -1.500 2.4e-03
permanent atrial fibrillation -1.300 9.0e-06
Pick disease 1.200 5.2e-04
pituitary cancer -3.300 8.0e-06
primitive neuroectodermal tumor -1.300 3.0e-03
psoriasis -1.600 3.2e-04
rhinitis with controlled asthma 1.100 2.8e-02
ulcerative colitis -1.300 4.4e-02

Gene RIF (245)

AA Sequence

MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITE      1 - 70
IFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDL     71 - 140
SELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEE    141 - 210
GKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVN    211 - 280
LTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDN    281 - 350
PTHMNNGDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST    351 - 420
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISNDDDSASPLHHISNGSNT    421 - 490
PSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNL    491 - 560
CPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLR    561 - 630
AHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRD    631 - 700
VYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGR    701 - 770
VLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG                      771 - 822
//

Text Mined References (287)

PMID Year Title