Property Summary

Ligand Count 468
NCBI Gene PubMed Count 282
PubMed Score 1050.91
PubTator Score 875.59

Knowledge Summary

Patent (130,834)

TINX Plot

  Disease (8)

Disease Target Count
Neurotrophic keratitis 2
Disease Target Count P-value
psoriasis 6694 6.8e-10
sonic hedgehog group medulloblastoma 467 7.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
lung cancer 4740 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 4.907 2.5

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.200 6.8e-10
sonic hedgehog group medulloblastoma 1.400 7.4e-03

PDB (29)

Gene RIF (198)

AA Sequence

MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTE      1 - 70
LYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSL     71 - 140
QELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDD    141 - 210
VLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQV    211 - 280
NVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQ    281 - 350
PTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSV    351 - 420
AVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHI    421 - 490
IENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQRE    491 - 560
AELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAV    561 - 630
ASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESIL    631 - 700
YRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQ    701 - 770
RHSIKDVHARLQALAQAPPVYLDVLG                                                771 - 796
//

Text Mined References (285)

PMID Year Title