Property Summary

NCBI Gene PubMed Count 7
PubMed Score 14.35
PubTator Score 93.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
tuberculosis 1963 7.7e-06
ovarian cancer 8297 2.2e-05
group 4 medulloblastoma 1806 1.2e-04
osteosarcoma 7766 4.2e-03
astrocytic glioma 2530 5.7e-03
ependymoma 4559 1.9e-02

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.200 5.7e-03
ependymoma -1.400 1.9e-02
group 4 medulloblastoma -1.200 1.2e-04
osteosarcoma -1.098 4.2e-03
ovarian cancer 2.000 2.2e-05
tuberculosis 1.200 7.7e-06

Synonym

Accession Q9BSD7 NTPase
Symbols C1orf57
HCR-NTPase

Gene

PANTHER Protein Class (2)

PDB

2I3B  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPP      1 - 70
PGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTII     71 - 140
LGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK                        141 - 190
//

Text Mined References (11)

PMID Year Title